Property Summary

NCBI Gene PubMed Count 26
Grant Count 15
R01 Count 8
Funding $567,367.85
PubMed Score 58.95
PubTator Score 14.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.572 0.003
psoriasis 2.700 0.000

Gene RIF (10)

PMID Text
26039076 a significant induction of three PGLYRPs 2-4 in primary human corneal epithelial cells (HCECs) exposed to live or heat-killed Candida albicans, is reported.
24838182 This study demonistrated that PGLYRP2 single-nucleotide polymorphisms is risk of Parkinson's disease.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16714290 pglyrp2 expression in skin and liver is important for systemic and local innate immune responses to bacterial infections
16239516 PGLYRP2 may function in the skin and the eyes as an inducible scavenger of proinflammatory peptidoglycan.
16054449 Serum N-acetylmuramoyl-l-alanine amidaseand liver PGLYRP2 are the same protein encoded by the pglyrp2 gene.
12669421 Various types of human blood cells were tested for expression of the Tag7/PGRP-SA and TagL/PGRP-L proteins, which belong to the family of proteins possessing the lysozyme-like peptidoglycan recognition protein (PGRP) domain

AA Sequence

MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL      1 - 70
LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL     71 - 140
PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS    141 - 210
PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV    211 - 280
ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH    281 - 350
LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT    351 - 420
DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL    421 - 490
PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR    491 - 560
SRREPPPRTLPATDLQ                                                          561 - 576
//

Text Mined References (28)

PMID Year Title
26039076 2015 A Novel Innate Response of Human Corneal Epithelium to Heat-killed Candida albicans by Producing Peptidoglycan Recognition Proteins.
24838182 2014 Peptidoglycan recognition protein genes and risk of Parkinson's disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16714290 2006 Differential expression of peptidoglycan recognition protein 2 in the skin and liver requires different transcription factors.
More...