Property Summary

NCBI Gene PubMed Count 20
Grant Count 13
R01 Count 6
Funding $567,236.65
PubMed Score 13.08
PubTator Score 16.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (12)

PMID Text
25061874 phosphorylation of DCBLD2 Y750 recruited TRAF6, leading to increased TRAF6 E3 ubiquitin ligase activity and subsequent activation of AKT, thereby enhancing EGFR-driven tumorigenesis
24177422 ESDN associates with VEGFR-2 and regulates its complex formation with negative regulators of VEGF signaling, protein tyrosine phosphatases PTP1B and TC-PTP, and VE-cadherin.
23770091 SFK activity was shown to be sufficient, but not required for the interaction between ESDN and the CrkL-SH2 domain
23036739 ESDN and AP-2g expression is lower in thick melanomas, it is associated with unfavourable histo-pathological parameters (increased vascularity, vascular invasion and mitoses) and correlates with a shorter DFS like for AP-2a.
22468095 Seven SNPs (rs1371687, rs7615856, rs828621, rs828618, rs828616, rs1062196, and rs8833) and one haplotype (DCBLD2-ht1) show associations with susceptibility to AERD.
22261696 These findings suggest that DCBLD2 could be a potential marker and drug target for treatment of nasal polyposis in Korean asthma patients.
21183991 The full-length signal peptides of DCBLD2 is functional and furthermore that the C-domains are sufficient and essential for ER targeting, whereas the N-domains are dispensable. Thus, the N-domains are available for additional functions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19696027 ESDN modulates PDGF signaling in VSMCs via regulation of PDGFR beta surface levels.
18314483 These data suggest that down-regulation of DCBLD2, often associated with promoter hypermethylation, is a frequent event that may be related to the development of gastric cancer.
More...

AA Sequence

MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGD      1 - 70
GCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVS     71 - 140
RTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKY    141 - 210
CPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHL    211 - 280
STSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQW    281 - 350
LQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNF    351 - 420
LPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFT    421 - 490
QPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKK    491 - 560
TEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIV    561 - 630
GTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTST    631 - 700
FKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDV    701 - 770
FKEIL                                                                     771 - 775
//

Text Mined References (22)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
25061874 2014 EGFR phosphorylation of DCBLD2 recruits TRAF6 and stimulates AKT-promoted tumorigenesis.
24177422 2013 Transmembrane protein ESDN promotes endothelial VEGF signaling and regulates angiogenesis.
23770091 2013 Tyrosine phosphorylation of the orphan receptor ESDN/DCBLD2 serves as a scaffold for the signaling adaptor CrkL.
23036739 2012 Expression of AP-2?, AP-2? and ESDN in primary melanomas: correlation with histopathological features and potential prognostic value.
22468095 2012 Potential association of DCBLD2 polymorphisms with fall rates of FEV(1) by aspirin provocation in Korean asthmatics.
22261696 2012 DCBLD2 gene variations correlate with nasal polyposis in Korean asthma patients.
21183991 2011 Long signal peptides of RGMa and DCBLD2 are dissectible into subdomains according to the NtraC model.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19696027 2009 Endothelial and smooth muscle-derived neuropilin-like protein regulates platelet-derived growth factor signaling in human vascular smooth muscle cells by modulating receptor ubiquitination.
More...