Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.53
PubTator Score 16.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.800 1.3e-02
adult high grade glioma -1.200 3.0e-03
atypical teratoid / rhabdoid tumor 1.100 7.7e-04
Breast cancer -1.300 1.6e-08
breast carcinoma -1.300 9.3e-06
chronic rhinosinusitis -1.040 3.2e-02
colon cancer 2.600 2.6e-02
glioblastoma 2.100 5.9e-03
group 3 medulloblastoma 2.200 4.3e-05
invasive ductal carcinoma -1.500 8.6e-04
juvenile dermatomyositis -1.162 4.8e-13
lung adenocarcinoma 1.100 1.8e-03
lung cancer 1.300 6.6e-03
lung carcinoma -1.200 6.2e-16
malignant mesothelioma -1.600 5.0e-07
medulloblastoma, large-cell 1.700 1.3e-04
non primary Sjogren syndrome sicca 1.200 1.3e-02
ovarian cancer -1.700 5.7e-05
pancreatic cancer 1.600 4.0e-03
posterior fossa group A ependymoma 1.100 5.5e-07
primary pancreatic ductal adenocarcinoma 1.743 6.0e-04
primitive neuroectodermal tumor 1.100 5.1e-03
psoriasis -3.100 9.8e-06

Gene RIF (14)

AA Sequence

MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGD      1 - 70
GCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVS     71 - 140
RTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKY    141 - 210
CPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHL    211 - 280
STSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQW    281 - 350
LQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNF    351 - 420
LPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFT    421 - 490
QPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKK    491 - 560
TEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIV    561 - 630
GTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTST    631 - 700
FKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDV    701 - 770
FKEIL                                                                     771 - 775
//

Text Mined References (24)

PMID Year Title