Property Summary

NCBI Gene PubMed Count 37
Grant Count 16
Funding $1,808,754.89
PubMed Score 0.00
PubTator Score 16.43

Knowledge Summary

Patent

No data available

Gene RIF (9)

PMID Text
25657029 These findings define an interaction between the common MIA2(I141M) variant and the ER stress/UPR system and specify a subgroup of PDAC patients who are more likely to benefit from adjuvant chemotherapy.
25202031 Sec12 recruitment to endoplasmic reticulum exit sites is organized by its direct interaction with cTAGE5, a previously characterized collagen cargo receptor component, which functions together with TANGO1 at endoplasmic reticulum exit sites.
23511560 Findings suggest that the roles of MIA2 might be based on the variety of the integrins and the subtypes of mitogen-activated protein kinase in oral carcinoma.
23054591 22 members of an Iranian family with basal ganglia calfication as well as 100 controls were genotyped for the C>G P521A variant of CTAGE5, but none were found.
22120627 HBx activates hepatoma cell growth and proliferation through repression of the potential tumor suppressor MIA2.
21525241 cTAGE5 forms a complex with TANGO1 (MIA3), a previously characterized cargo receptor for collagen VII
20838928 population and bioinformatic analysis of MGEA6 P521A variation as a risk factor for Fahr's disease; genetic screen data show this mutation is very rare; bioinformatics analysis provided conflicting findings
17881540 The novel gene MIA2 acts as a tumour suppressor in hepatocellular carcinoma.
12586826 Data indicate that MIA2 represents a potential novel acute phase protein and MIA2 expression responds to liver damage in chronic liver diseases.

AA Sequence

MAKFGVHRILLLAISLTKCLESTKLLADLKKCGDLECEALINRVSAMRDYRGPDCRYLNFTKGEEISVYV      1 - 70
KLAGEREDLWAGSKGKEFGYFPRDAVQIEEVFISEEIQMSTKESDFLCLLGVSYTFDNEDSELNGDYGEN     71 - 140
IYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPEDIGSTSESKDWEEVVVESMEQDRIP    141 - 210
EVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTEHQQES    211 - 280
ESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKE    281 - 350
ATVPCTEILTEKKDTITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELD    351 - 420
PEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIPYLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNN    421 - 490
VIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDTEG    491 - 560
PALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERV    561 - 630
VAALPEGMRPDSNLYGFPWELVICAAVVGFFAVLFFLWRSFRSVRSRLYVGREKKLALMLSGLIEEKSKL    631 - 700
LEKFSLVQKEYEGYEVESSLKDASFEKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQ    701 - 770
DELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQEAEVW    771 - 840
KEQVSELNKQKVTFEDSKVHAEQVLNDKESHIKTLTERLLKMKDWAAMLGEDITDDDNLELEMNSESENG    841 - 910
AYLDNPPKGALKKLIHAAKLNASLKTLEGERNQIYIQLSEVDKTKEELTEHIKNLQTEQASLQSENTHFE    911 - 980
NENQKLQQKLKVMTELYQENEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEEL    981 - 1050
ERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDVPNTAF   1051 - 1120
GREHSPYGPSPLGWPSSETRAFLSPPTLLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRL   1121 - 1190
TDPHRAPSDTGSLSPPWDQDRRMMFPPPGQSYPDSALPPQRQDRFCSNSGRLSGPAELRSFNMPSLDKMD   1191 - 1260
GSMPSEMESSRNDTKDDLGNLNVPDSSLPAENEATGPGFVPPPLAPIRGPLFPVDARGPFLRRGPPFPPP   1261 - 1330
PPGAMFGASRDYFPPGDFPGPPPAPFAMRNVYPPRGFPPYLPPRPGFFPPPPHSEGRSEFPSGLIPPSNE   1331 - 1400
PATEHPEPQQET                                                             1401 - 1412
//

Text Mined References (37)

PMID Year Title
27170179 2016 Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.
27138255 2016 TANGO1 and Mia2/cTAGE5 (TALI) cooperate to export bulky pre-chylomicrons/VLDLs from the endoplasmic reticulum.
25657029 2015 A common genetic variation of melanoma inhibitory activity-2 labels a subtype of pancreatic adenocarcinoma with high endoplasmic reticulum stress levels.
25416956 2014 A proteome-scale map of the human interactome network.
25202031 2014 Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23511560 2013 Protumoral roles of melanoma inhibitory activity 2 in oral squamous cell carcinoma.
23054591 2013 Analysis of the CTAGE5 P521A variation with the risk of familial idiopathic basal ganglia calcification in an Iranian population.
22120627 2011 The X protein of hepatitis B virus activates hepatoma cell proliferation through repressing melanoma inhibitory activity 2 gene.
21807889 2011 Reduced cholesterol and triglycerides in mice with a mutation in Mia2, a liver protein that localizes to ER exit sites.
More...