Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.77
PubTator Score 1.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q96PC3 B4DQZ1 Q8WTY1 Q96DD1
Symbols PSORS15

Gene

PDB

4HMY  

Gene RIF (24)

PMID Text
25496667 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24791904 AP1S3 silencing disrupted the endosomal translocation of the innate pattern-recognition receptor TLR-3 (Toll-like receptor 3) and resulted in a marked inhibition of downstream signaling.
23705972 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23705972 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23678182 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23077317 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23077317 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21762802 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21762802 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCA      1 - 70
IENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDM     71 - 140
LQEVSTVSQTMGER                                                            141 - 154
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24791904 2014 AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.
23575750 2013 Replication of Caucasian loci associated with bone mineral density in Koreans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15569716 2004 HIV-1 Nef disrupts MHC-I trafficking by recruiting AP-1 to the MHC-I cytoplasmic tail.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694590 2001 GGAs: roles of the different domains and comparison with AP-1 and clathrin.
More...