Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.77
PubTator Score 1.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 1.3537793511529E-54
pancreatic cancer 2300 9.68230006249638E-9
medulloblastoma, large-cell 6234 1.55705197197661E-5
tuberculosis 1563 1.8180346253407E-5
osteosarcoma 7933 3.55283723807847E-5
interstitial cystitis 2299 9.50689196797664E-5
ovarian cancer 8492 2.13669234834496E-4
ulcerative colitis 2087 5.26053959837305E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.66061720295003E-4
Atopic dermatitis 944 0.00169341914826386
adult high grade glioma 2148 0.00228281792407204
medulloblastoma 1524 0.00305007947509808
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00712488409933543
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00846811319261034
atypical teratoid / rhabdoid tumor 4369 0.0103171323266719
urothelial carcinoma 318 0.0253849274731679
spina bifida 1064 0.0443682040447914
Disease Target Count
pustulosis of palm and sole 5
Disease Target Count
Psoriasis 15, pustular 1

Expression

  Differential Expression (17)

Synonym

Accession Q96PC3 B4DQZ1 Q8WTY1 Q96DD1
Symbols PSORS15

Gene

PDB

4HMY  

  Ortholog (11)

Gene RIF (17)

PMID Text
25496667 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24791904 AP1S3 silencing disrupted the endosomal translocation of the innate pattern-recognition receptor TLR-3 (Toll-like receptor 3) and resulted in a marked inhibition of downstream signaling.
23705972 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23678182 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23077317 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21762802 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16253302 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
15681409 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
12836198 Genome-wide shRNA screening identifies AP1S3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
More...

AA Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCA      1 - 70
IENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDM     71 - 140
LQEVSTVSQTMGER                                                            141 - 154
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24791904 2014 AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.
23575750 2013 Replication of Caucasian loci associated with bone mineral density in Koreans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15569716 2004 HIV-1 Nef disrupts MHC-I trafficking by recruiting AP-1 to the MHC-I cytoplasmic tail.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694590 2001 GGAs: roles of the different domains and comparison with AP-1 and clathrin.
More...