Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.28
PubTator Score 1.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.200 1.4e-54
adult high grade glioma -1.100 2.3e-03
Atopic dermatitis 1.100 1.7e-03
atypical teratoid / rhabdoid tumor 1.800 1.0e-02
group 4 medulloblastoma -1.200 1.5e-03
interstitial cystitis -1.700 2.6e-02
intraductal papillary-mucinous adenoma (... 2.000 9.7e-04
intraductal papillary-mucinous carcinoma... 1.700 8.5e-03
intraductal papillary-mucinous neoplasm ... 2.300 7.1e-03
medulloblastoma, large-cell -2.000 1.6e-05
osteosarcoma -1.374 3.6e-05
ovarian cancer -1.600 2.1e-04
pancreatic cancer 2.200 9.7e-09
spina bifida -1.030 4.4e-02
tuberculosis -1.200 1.8e-05
ulcerative colitis 1.800 5.3e-04
urothelial carcinoma -1.600 2.5e-02

Gene RIF (18)

AA Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCA      1 - 70
IENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDM     71 - 140
LQEVSTVSQTMGER                                                            141 - 154
//

Text Mined References (15)

PMID Year Title