Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
acute quadriplegic myopathy 1157 6.44941903574234E-7
psoriasis 6685 1.84092915004271E-6
atypical teratoid/rhabdoid tumor 1095 7.98995430908546E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0042417778160999
pilocytic astrocytoma 3086 0.00427224110988284
pediatric high grade glioma 2712 0.0103687950251826
head and neck cancer and chronic obstructive pulmonary disease 237 0.01209449042115
diabetes mellitus 1663 0.0143822831564765
group 4 medulloblastoma 1875 0.0156556169692215
ependymoma 2514 0.023346509464752
head and neck cancer 270 0.0279425886697848
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0

Expression

Synonym

Accession Q96PC2 Q96MQ9 InsP6 kinase 3
Symbols IHPK3
INSP6K3

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVT      1 - 70
VHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPA     71 - 140
KALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTH    141 - 210
PCVLDLKMGTRQHGDDASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGF    211 - 280
RQALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQ    281 - 350
AAHGSSPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE              351 - 410
//

Text Mined References (8)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11502751 2001 Identification and characterization of a novel inositol hexakisphosphate kinase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.