Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.723 6.4e-07
Astrocytoma, Pilocytic -1.300 5.1e-03
atypical teratoid/rhabdoid tumor -1.300 8.0e-04
diabetes mellitus -1.100 1.4e-02
ependymoma -1.200 2.3e-02
group 4 medulloblastoma -1.300 1.6e-02
head and neck cancer -1.400 2.8e-02
head and neck cancer and chronic obstruc... -1.100 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.897 4.2e-03
pediatric high grade glioma -1.100 1.0e-02
psoriasis -1.100 1.8e-06

Gene RIF (1)

AA Sequence

MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVT      1 - 70
VHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPA     71 - 140
KALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTH    141 - 210
PCVLDLKMGTRQHGDDASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGF    211 - 280
RQALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQ    281 - 350
AAHGSSPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE              351 - 410
//

Text Mined References (8)

PMID Year Title