Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.91
PubTator Score 13.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.800 0.048
posterior fossa group A ependymoma -3.100 0.000
oligodendroglioma -2.000 0.012
glioblastoma -4.200 0.000
medulloblastoma -4.400 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
medulloblastoma, large-cell -3.700 0.001
primitive neuroectodermal tumor -2.400 0.013
acute quadriplegic myopathy -1.030 0.006
interstitial cystitis -4.600 0.000
pediatric high grade glioma -3.500 0.000
pilocytic astrocytoma -2.700 0.000
Pick disease -1.400 0.017
ovarian cancer -1.200 0.005
pituitary cancer 3.500 0.000
psoriasis -1.900 0.000

Gene RIF (6)

PMID Text
24839112 LRRC3B gene expression and promoter hypermethylation in breast carcinomas
22321817 Data suggest that LRRC3B gene could be involved in the process of carcinogenesis as a tumor suppressor gene.
22101383 The LRRC3B gene promoter was methylated in 43% of clear cell renal carcinoma samples.
18815942 LRRC3B may be a novel methylation-sensitive tumor suppressor gene in CRC. LRRC3B methylation has significant tumor specificity and may be a biomarker of CRC.
18757430 suggest that LRRC3B is a putative tumor suppressor gene that is silenced in gastric cancers by epigenetic mechanisms and that LRRC3B silencing in cancer may play an important role in tumor escape from immune surveillance
18377727 The expression of LRP15 is controlled by methylation in its promoter in HeLa cells, and LRP15 confers resistance to ultraviolet rays damage and accelerates the DNA repair rate.

AA Sequence

MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLY      1 - 70
LDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARA     71 - 140
RIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTM    141 - 210
FGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV                         211 - 259
//

Text Mined References (13)

PMID Year Title
26276358 2016 LRRC3B is downregulated in non-small-cell lung cancer and inhibits cancer cell proliferation and invasion.
24839112 2014 The clinical value of LRRC3B gene expression and promoter hypermethylation in breast carcinomas.
22321817 2012 LRRC3B gene is frequently epigenetically inactivated in several epithelial malignancies and inhibits cell growth and replication.
22101383 2012 Methylation pattern of the putative tumor-suppressor gene LRRC3B promoter in clear cell renal cell carcinomas.
18815942 2009 Epigenetic silencing of LRRC3B in colorectal cancer.
18757430 2008 LRRC3B, encoding a leucine-rich repeat-containing protein, is a putative tumor suppressor gene in gastric cancer.
18377727 2008 The novel gene LRP15 is regulated by DNA methylation and confers increased efficiency of DNA repair of ultraviolet-induced DNA damage.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...