Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.11
PubTator Score 13.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy -1.030 5.8e-03
adult high grade glioma -2.100 7.8e-04
astrocytic glioma -1.800 4.8e-02
Astrocytoma, Pilocytic -2.700 4.9e-05
atypical teratoid / rhabdoid tumor -4.700 8.2e-13
ependymoma -2.800 1.4e-02
glioblastoma -2.700 3.5e-05
group 3 medulloblastoma -2.700 2.2e-03
interstitial cystitis -3.400 1.9e-03
medulloblastoma, large-cell -3.700 1.5e-03
oligodendroglioma -2.000 1.2e-02
ovarian cancer -1.200 4.6e-03
Pick disease -1.400 1.7e-02
pituitary cancer 3.500 1.6e-05
primitive neuroectodermal tumor -2.400 1.3e-02
psoriasis -1.900 1.5e-13

Gene RIF (8)

AA Sequence

MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLY      1 - 70
LDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARA     71 - 140
RIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTM    141 - 210
FGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV                         211 - 259
//

Text Mined References (14)

PMID Year Title