Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.22
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.300 3.0e-06
astrocytic glioma -3.600 1.1e-03
Astrocytoma, Pilocytic -4.400 3.1e-15
atypical teratoid / rhabdoid tumor -3.700 6.9e-07
ependymoma -4.000 7.4e-04
glioblastoma -3.700 1.2e-11
group 3 medulloblastoma -1.800 1.4e-02
medulloblastoma, large-cell -3.000 1.1e-03
oligodendroglioma -3.200 5.5e-03
Pick disease -1.600 9.3e-03
primitive neuroectodermal tumor -3.400 3.6e-04
subependymal giant cell astrocytoma -2.831 5.3e-03

Gene RIF (5)

AA Sequence

MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTLTQISPKEGWQVYSSAQDPDGRCICTVV      1 - 70
APEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMT     71 - 140
KHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRL    141 - 210
RDCMKKLTCGKLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAE    211 - 280
SRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLM    281 - 350
ADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY    351 - 420
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT                421 - 478
//

Text Mined References (16)

PMID Year Title