Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
Funding $716,165.79
PubMed Score 6.10
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.600 0.001
ependymoma -4.800 0.000
oligodendroglioma -3.200 0.006
glioblastoma -5.100 0.000
group 3 medulloblastoma -2.800 0.008
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -4.000 0.000
pediatric high grade glioma -4.400 0.000
pilocytic astrocytoma -4.700 0.000
subependymal giant cell astrocytoma -2.831 0.005
Pick disease -1.600 0.009

Gene RIF (5)

PMID Text
22281030 This is the first instance of OLFM3 being linked with anoikis resistance in a human cancer cell line
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16115881 Pax6 regulation of Optimedin in the eye and brain may directly affect multiple developmental processes, including cell migration and axon growth
12019210 identification of a novel olfactomedin-related gene, named optimedin, located on chromosome 1p21 in humans, expressed in brain and retina; may be a candidate gene for disorders involving the anterior segment of the eye and the retina (optimedin)

AA Sequence

MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTLTQISPKEGWQVYSSAQDPDGRCICTVV      1 - 70
APEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMT     71 - 140
KHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRL    141 - 210
RDCMKKLTCGKLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAE    211 - 280
SRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLM    281 - 350
ADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY    351 - 420
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT                421 - 478
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24351856 2014 An integrative study of the genetic, social and environmental determinants of chronic kidney disease characterized by tubulointerstitial damages in the North Central Region of Sri Lanka.
22281030 2012 Olfactomedin III expression contributes to anoikis-resistance in clonal variants of a human lung squamous carcinoma cell line.
21228389 2011 Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115881 2005 The Optimedin gene is a downstream target of Pax6.
More...