Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.00
PubTator Score 54.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.35431682106855E-5
Pick disease 1893 0.00377627012209007
colon cancer 1475 0.0119260090610257
group 3 medulloblastoma 2254 0.0143665630382341
Breast cancer 3099 0.0215258560780546
Disease Target Count
Dystonia 11, Myoclonic 3

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.500 0.012
Breast cancer 4.500 0.022
group 3 medulloblastoma 1.200 0.014
Pick disease -1.600 0.004
ovarian cancer -1.600 0.000

Synonym

Accession Q96PB1 B3KW13 O14574 Q3LIE2 Q6P4R4 Q9H6T9 Q9H770
Symbols C7orf12
NBLA04196

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
26169044 CASD1 is a sialate O-acetyltransferase and serves as key enzyme in the biosynthesis of 9-O-acetylated sialoglycans.
20947662 human Cas1 protein is directly involved in O-acetylation of alpha2-8-linked sialic acids

AA Sequence

MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCM      1 - 70
MHKYKISEAKNCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKTASVKVDFLWHPEV     71 - 140
NGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQD    141 - 210
PVYEDLLSENRKMITNEKIDAYNEAAVSILNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRE    211 - 280
TTAMILMNVYCNKILKPVDGSCCQPRPPVTLIQKLAACFFTLSIIGYLIFYIIHRNAHRKNKPCTDLESG    281 - 350
EEKKNIINTPVSSLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIPIIYILVLGVFYNENT    351 - 420
KETKVLNREQTDEWKGWMQLVILIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFWIKGDFGIYRV    421 - 490
CQVLFRLNFLVVVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQIIQKKANGNCFWHFGLLLKLGFL    491 - 560
LLFICFLAYSQGAFEKIFSLWPLSKCFELKGNVYEWWFRWRLDRYVVFHGMLFAFIYLALQKRQILSEGK    561 - 630
GEPLFSNKISNFLLFISVVSFLTYSIWASSCKNKAECNELHPSVSVVQILAFILIRNIPGYARSVYSSFF    631 - 700
AWFGKISLELFICQYHIWLAADTRGILVLIPGNPMLNIIVSTFIFVCVAHEISQITNDLAQIIIPKDNSS    701 - 770
LLKRLACIAAFFCGLLILSSIQDKSKH                                               771 - 797
//

Text Mined References (10)

PMID Year Title
26169044 2015 9-O-Acetylation of sialic acids is catalysed by CASD1 via a covalent acetyl-enzyme intermediate.
20947662 2011 The human Cas1 protein: a sialic acid-specific O-acetyltransferase?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11703667 2001 Cas1p is a membrane protein necessary for the O-acetylation of the Cryptococcus neoformans capsular polysaccharide.
11528394 2001 Mutations in the gene encoding epsilon-sarcoglycan cause myoclonus-dystonia syndrome.