Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.00
PubTator Score 54.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.4e-05
Pick disease 1894 3.8e-03
colon cancer 1478 1.2e-02
group 3 medulloblastoma 4104 1.4e-02
Breast cancer 3578 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Dystonia 11, Myoclonic 3

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 4.500 2.2e-02
colon cancer -1.500 1.2e-02
group 3 medulloblastoma 1.200 1.4e-02
ovarian cancer -1.600 3.4e-05
Pick disease -1.600 3.8e-03

Gene RIF (2)

AA Sequence

MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCM      1 - 70
MHKYKISEAKNCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKTASVKVDFLWHPEV     71 - 140
NGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQD    141 - 210
PVYEDLLSENRKMITNEKIDAYNEAAVSILNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRE    211 - 280
TTAMILMNVYCNKILKPVDGSCCQPRPPVTLIQKLAACFFTLSIIGYLIFYIIHRNAHRKNKPCTDLESG    281 - 350
EEKKNIINTPVSSLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIPIIYILVLGVFYNENT    351 - 420
KETKVLNREQTDEWKGWMQLVILIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFWIKGDFGIYRV    421 - 490
CQVLFRLNFLVVVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQIIQKKANGNCFWHFGLLLKLGFL    491 - 560
LLFICFLAYSQGAFEKIFSLWPLSKCFELKGNVYEWWFRWRLDRYVVFHGMLFAFIYLALQKRQILSEGK    561 - 630
GEPLFSNKISNFLLFISVVSFLTYSIWASSCKNKAECNELHPSVSVVQILAFILIRNIPGYARSVYSSFF    631 - 700
AWFGKISLELFICQYHIWLAADTRGILVLIPGNPMLNIIVSTFIFVCVAHEISQITNDLAQIIIPKDNSS    701 - 770
LLKRLACIAAFFCGLLILSSIQDKSKH                                               771 - 797
//

Text Mined References (11)

PMID Year Title