Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.00
PubTator Score 54.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.500 0.012
Breast cancer 4.500 0.022
group 3 medulloblastoma 1.200 0.014
Pick disease -1.600 0.004
ovarian cancer -1.600 0.000

Gene RIF (2)

PMID Text
26169044 CASD1 is a sialate O-acetyltransferase and serves as key enzyme in the biosynthesis of 9-O-acetylated sialoglycans.
20947662 human Cas1 protein is directly involved in O-acetylation of alpha2-8-linked sialic acids

AA Sequence

MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCM      1 - 70
MHKYKISEAKNCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKTASVKVDFLWHPEV     71 - 140
NGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQD    141 - 210
PVYEDLLSENRKMITNEKIDAYNEAAVSILNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRE    211 - 280
TTAMILMNVYCNKILKPVDGSCCQPRPPVTLIQKLAACFFTLSIIGYLIFYIIHRNAHRKNKPCTDLESG    281 - 350
EEKKNIINTPVSSLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIPIIYILVLGVFYNENT    351 - 420
KETKVLNREQTDEWKGWMQLVILIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFWIKGDFGIYRV    421 - 490
CQVLFRLNFLVVVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQIIQKKANGNCFWHFGLLLKLGFL    491 - 560
LLFICFLAYSQGAFEKIFSLWPLSKCFELKGNVYEWWFRWRLDRYVVFHGMLFAFIYLALQKRQILSEGK    561 - 630
GEPLFSNKISNFLLFISVVSFLTYSIWASSCKNKAECNELHPSVSVVQILAFILIRNIPGYARSVYSSFF    631 - 700
AWFGKISLELFICQYHIWLAADTRGILVLIPGNPMLNIIVSTFIFVCVAHEISQITNDLAQIIIPKDNSS    701 - 770
LLKRLACIAAFFCGLLILSSIQDKSKH                                               771 - 797
//

Text Mined References (10)

PMID Year Title
26169044 2015 9-O-Acetylation of sialic acids is catalysed by CASD1 via a covalent acetyl-enzyme intermediate.
20947662 2011 The human Cas1 protein: a sialic acid-specific O-acetyltransferase?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11703667 2001 Cas1p is a membrane protein necessary for the O-acetylation of the Cryptococcus neoformans capsular polysaccharide.
11528394 2001 Mutations in the gene encoding epsilon-sarcoglycan cause myoclonus-dystonia syndrome.