Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.35
PubTator Score 5.50

Knowledge Summary

Patent (368)

Gene RIF (7)

AA Sequence

MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLG      1 - 70
AAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIV     71 - 140
LSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEV    141 - 210
PPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRR    211 - 280
AGETKGISITSI                                                              281 - 292
//

Text Mined References (19)

PMID Year Title