Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.75
PubTator Score 5.50

Knowledge Summary

Patent (368)

Synonym

Accession Q96P88 E7EN27 Q8TCX8 GnRH II receptor
Symbols GnRH-II-R

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
20630060 Data indicate that GnRH-II antagonists seem to be suitable drugs for an efficacious and less-toxic endocrine therapy for breast cancers, including triple-negative breast cancers.
20398908 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17296196 Expression of GnRH2 protein and receptor (GnRHR2) is confirmed in both leiomyoma and patient-matched myometrium.
16189182 Immune histological sections of human placenta and human endometrial, ovarian, and prostate cancers using rabbit anti-human GnRH-II receptor antiserum showed GnRH-II receptor-like staining.
15761034 the GnRHR-II-reliquum plays a modulatory role in GnRHR-I expression

AA Sequence

MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLG      1 - 70
AAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIV     71 - 140
LSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEV    141 - 210
PPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRR    211 - 280
AGETKGISITSI                                                              281 - 292
//

Publication (19)

PMID Year Title
20630060 2010 Gonadotropin-releasing hormone type II antagonist induces apoptosis in MCF-7 and triple-negative MDA-MB-231 human breast cancer cells in vitro and in vivo.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19657181 2009 Retention and silencing of prepro-GnRH-II and type II GnRH receptor genes in mammals.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17296196 2007 Human myometrium and leiomyomas express gonadotropin-releasing hormone 2 and gonadotropin-releasing hormone 2 receptor.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...