Tbio | N-terminal EF-hand calcium-binding protein 3 |
Inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP), and hence allows formation of beta-amyloid.
The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 8.9703025098647E-9 |
pilocytic astrocytoma | 3086 | 2.83777478115597E-7 |
glioblastoma | 5572 | 7.33848427686122E-6 |
atypical teratoid/rhabdoid tumor | 1095 | 2.32289397264447E-5 |
psoriasis | 6685 | 1.72724572233777E-4 |
adult high grade glioma | 2148 | 0.001069425719223 |
group 3 medulloblastoma | 2254 | 0.0158870258741126 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -1.400 | 0.000 |
osteosarcoma | 2.016 | 0.000 |
glioblastoma | -1.100 | 0.000 |
adult high grade glioma | -1.300 | 0.001 |
atypical teratoid/rhabdoid tumor | -1.100 | 0.000 |
group 3 medulloblastoma | -1.100 | 0.016 |
pilocytic astrocytoma | -1.400 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
21048031 | Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) |
20237496 | Observational study of gene-disease association. (HuGE Navigator) |
19035353 | xb51 may be required for maturation and maintenance of xb51-expressing neurons in the forebrain |
18854154 | Knockdown of N-terminal EF-hand calcium binding protein 3 (NECAB3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1 |
12780348 | hXB51 isoforms regulate Abeta generation differently, either enhancing it by modifying the association of X11L with APP or suppressing it in an X11L-independent manner |
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL 1 - 70 SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF 71 - 140 VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG 141 - 210 SSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLE 211 - 280 PLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQ 281 - 350 DEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN 351 - 396 //
PMID | Year | Title |
---|---|---|
21048031 | 2011 | Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph. |
20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. |
19035353 | 2008 | Isolation and expression analysis of Alzheimer's disease-related gene xb51 in zebrafish. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
14697346 | 2004 | NIP1/XB51/NECAB3 is a potential substrate of Nek2, suggesting specific roles of Nek2 in Golgi. |
12780348 | 2003 | XB51 isoforms mediate Alzheimer's beta-amyloid peptide production by X11L (X11-like protein)-dependent and -independent mechanisms. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
12044471 | 2002 | NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern. |
11780052 | 2001 | The DNA sequence and comparative analysis of human chromosome 20. |
More... |