Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.89
PubTator Score 5.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-03
Astrocytoma, Pilocytic -1.400 1.2e-07
atypical teratoid/rhabdoid tumor -1.100 2.3e-05
glioblastoma -1.100 7.3e-06
group 3 medulloblastoma -1.100 1.6e-02
osteosarcoma 2.016 9.0e-09
psoriasis -1.400 1.7e-04

Synonym

Accession Q96P71 A8K780 E1P5N2 Q5JWF5 Q5JWF6 Q5JWF7 Q86VV1 Q9H433 Q9H8G8 Q9HBW7 Q9HCQ9
Symbols NIP1
XB51
STIP3
EFCBP3
SYTIP2
APBA2BP
dJ63M2.4
dJ63M2.5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL      1 - 70
SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF     71 - 140
VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG    141 - 210
SSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLE    211 - 280
PLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQ    281 - 350
DEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN                            351 - 396
//

Text Mined References (14)

PMID Year Title