Property Summary

NCBI Gene PubMed Count 13
Grant Count 12
R01 Count 12
Funding $513,759.74
PubMed Score 4.93
PubTator Score 5.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 2.016 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.300 0.001
atypical teratoid/rhabdoid tumor -1.100 0.000
group 3 medulloblastoma -1.100 0.016
pilocytic astrocytoma -1.400 0.000

Gene RIF (5)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19035353 xb51 may be required for maturation and maintenance of xb51-expressing neurons in the forebrain
18854154 Knockdown of N-terminal EF-hand calcium binding protein 3 (NECAB3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12780348 hXB51 isoforms regulate Abeta generation differently, either enhancing it by modifying the association of X11L with APP or suppressing it in an X11L-independent manner

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL      1 - 70
SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF     71 - 140
VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG    141 - 210
SSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLE    211 - 280
PLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQ    281 - 350
DEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN                            351 - 396
//

Text Mined References (13)

PMID Year Title
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19035353 2008 Isolation and expression analysis of Alzheimer's disease-related gene xb51 in zebrafish.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697346 2004 NIP1/XB51/NECAB3 is a potential substrate of Nek2, suggesting specific roles of Nek2 in Golgi.
12780348 2003 XB51 isoforms mediate Alzheimer's beta-amyloid peptide production by X11L (X11-like protein)-dependent and -independent mechanisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...