Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.93
PubTator Score 5.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.9703025098647E-9
pilocytic astrocytoma 3086 2.83777478115597E-7
glioblastoma 5572 7.33848427686122E-6
atypical teratoid/rhabdoid tumor 1095 2.32289397264447E-5
psoriasis 6685 1.72724572233777E-4
adult high grade glioma 2148 0.001069425719223
group 3 medulloblastoma 2254 0.0158870258741126

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 2.016 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.300 0.001
atypical teratoid/rhabdoid tumor -1.100 0.000
group 3 medulloblastoma -1.100 0.016
pilocytic astrocytoma -1.400 0.000

Synonym

Accession Q96P71 A8K780 E1P5N2 Q5JWF5 Q5JWF6 Q5JWF7 Q86VV1 Q9H433 Q9H8G8 Q9HBW7 Q9HCQ9
Symbols NIP1
XB51
STIP3
EFCBP3
SYTIP2
APBA2BP
dJ63M2.4
dJ63M2.5

Gene

  Ortholog (11)

Gene RIF (5)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19035353 xb51 may be required for maturation and maintenance of xb51-expressing neurons in the forebrain
18854154 Knockdown of N-terminal EF-hand calcium binding protein 3 (NECAB3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12780348 hXB51 isoforms regulate Abeta generation differently, either enhancing it by modifying the association of X11L with APP or suppressing it in an X11L-independent manner

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL      1 - 70
SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF     71 - 140
VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG    141 - 210
SSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLE    211 - 280
PLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQ    281 - 350
DEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN                            351 - 396
//

Text Mined References (13)

PMID Year Title
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19035353 2008 Isolation and expression analysis of Alzheimer's disease-related gene xb51 in zebrafish.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697346 2004 NIP1/XB51/NECAB3 is a potential substrate of Nek2, suggesting specific roles of Nek2 in Golgi.
12780348 2003 XB51 isoforms mediate Alzheimer's beta-amyloid peptide production by X11L (X11-like protein)-dependent and -independent mechanisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...