Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $349,609.66
PubMed Score 12.18
PubTator Score 9.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.200 0.005
psoriasis 1.300 0.001
osteosarcoma 1.481 0.000
group 4 medulloblastoma 1.200 0.000
astrocytoma 1.500 0.018
glioblastoma 1.100 0.002
primitive neuroectodermal tumor 1.100 0.015
acute quadriplegic myopathy 1.014 0.000
lung cancer 1.500 0.001
pediatric high grade glioma 1.200 0.000
ovarian cancer 1.600 0.000

Gene RIF (3)

PMID Text
23851686 IPO9 associates with 2 stable stem-loop structures of the IFN-epsilon 5'UTR. IPO9 overexpression decreased, and IPO9 silencing increased basal IFN-epsilon expression.
22190034 HIV-1 Vpu is identified to have a physical interaction with importin 9 (IPO9) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12670497 specific interaction between a member of the importin beta/karyopherin beta superfamily, importin 9, and the A subunit of PP2A (PR65)

AA Sequence

MAAAAAAGAASGLPGPVAQGLKEALVDTLTGILSPVQEVRAAAEEQIKVLEVTEEFGVHLAELTVDPQGA      1 - 70
LAIRQLASVILKQYVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRESISKVRSSVAYAVSAIAHWDW     71 - 140
PEAWPQLFNLLMEMLVSGDLNAVHGAMRVLTEFTREVTDTQMPLVAPVILPEMYKIFTMAEVYGIRTRSR    141 - 210
AVEIFTTCAHMICNMEELEKGAAKVLIFPVVQQFTEAFVQALQIPDGPTSDSGFKMEVLKAVTALVKNFP    211 - 280
KHMVSSMQQILPIVWNTLTESAAFYVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFK    281 - 350
STVKKALPELIYYIILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAAA    351 - 420
LAAAATRHLQEAEQTKNSGTEHWWKIHEACMLALGSVKAIITDSVKNGRIHFDMHGFLTNVILADLNLSV    421 - 490
SPFLLGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRAIWGYCDQLKVSESTHVLQPF    491 - 560
LPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTASMESKICPFTIAIFLKYSNDPVVASLAQDIF    561 - 630
KELSQIEACQGPMQMRLIPTLVSIMQAPADKIPAGLCATAIDILTTVVRNTKPPLSQLLICQAFPAVAQC    631 - 700
TLHTDDNATMQNGGECLRAYVSVTLEQVAQWHDEQGHNGLWYVMQVVSQLLDPRTSEFTAAFVGRLVSTL    701 - 770
ISKAGRELGENLDQILRAILSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFVM    771 - 840
AEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSKSAKNPERWTN    841 - 910
IPLLVKILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYE    911 - 980
EDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPCYIMFSGHLNDNERRVLQTIGI             981 - 1041
//

Publication (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23851686 2013 Novel role for molecular transporter importin 9 in posttranscriptional regulation of IFN-? expression.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
More...