Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.18
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.014 5.5e-07
astrocytoma 1.500 1.8e-02
glioblastoma 1.100 2.0e-03
group 3 medulloblastoma 1.100 2.1e-03
lung cancer 1.500 7.2e-04
oligodendroglioma 1.200 5.2e-03
osteosarcoma 1.481 2.4e-04
ovarian cancer 1.600 4.1e-06
pediatric high grade glioma 1.200 1.6e-05
primitive neuroectodermal tumor 1.100 1.5e-02
psoriasis 1.300 6.3e-04

Gene RIF (4)

AA Sequence

MAAAAAAGAASGLPGPVAQGLKEALVDTLTGILSPVQEVRAAAEEQIKVLEVTEEFGVHLAELTVDPQGA      1 - 70
LAIRQLASVILKQYVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRESISKVRSSVAYAVSAIAHWDW     71 - 140
PEAWPQLFNLLMEMLVSGDLNAVHGAMRVLTEFTREVTDTQMPLVAPVILPEMYKIFTMAEVYGIRTRSR    141 - 210
AVEIFTTCAHMICNMEELEKGAAKVLIFPVVQQFTEAFVQALQIPDGPTSDSGFKMEVLKAVTALVKNFP    211 - 280
KHMVSSMQQILPIVWNTLTESAAFYVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFK    281 - 350
STVKKALPELIYYIILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAAA    351 - 420
LAAAATRHLQEAEQTKNSGTEHWWKIHEACMLALGSVKAIITDSVKNGRIHFDMHGFLTNVILADLNLSV    421 - 490
SPFLLGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRAIWGYCDQLKVSESTHVLQPF    491 - 560
LPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTASMESKICPFTIAIFLKYSNDPVVASLAQDIF    561 - 630
KELSQIEACQGPMQMRLIPTLVSIMQAPADKIPAGLCATAIDILTTVVRNTKPPLSQLLICQAFPAVAQC    631 - 700
TLHTDDNATMQNGGECLRAYVSVTLEQVAQWHDEQGHNGLWYVMQVVSQLLDPRTSEFTAAFVGRLVSTL    701 - 770
ISKAGRELGENLDQILRAILSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFVM    771 - 840
AEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSKSAKNPERWTN    841 - 910
IPLLVKILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYE    911 - 980
EDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPCYIMFSGHLNDNERRVLQTIGI             981 - 1041
//

Text Mined References (24)

PMID Year Title