Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.09
PubTator Score 7.50

Knowledge Summary

Patent (795)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.400 0.030
lung adenocarcinoma 1.700 0.000

Gene RIF (3)

PMID Text
19328558 Observational study of gene-disease association. (HuGE Navigator)
16389273 Observational study of gene-disease association. (HuGE Navigator)
16389273 Two haplotypes remained significant in both the female bipolar affective disorder individuals and in the full sample of affected female individuals. Results provide preliminary evidence for involvement of GPR78 in susceptibility to BPAD and SCZ.

AA Sequence

MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDMPFTLLGVMRG      1 - 70
RTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRPRYAGLLLGCAWGQSLAFSGA     71 - 140
ALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVGFVLPLAVLCLTSLQVHRVARRHCQRMDTVT    141 - 210
MKALALLADLHPSVRQRCLIQQKRRRHRATRKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSK    211 - 280
CLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGS    281 - 350
VDTENDSCLQQTH                                                             351 - 363
//

Publication (8)

PMID Year Title
21660448 2012 5, 7-Dimethoxyflavone sensitizes TRAIL-induced apoptosis through DR5 upregulation in hepatocellular carcinoma cells.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
17363172 2007 Tissue distribution and functional analyses of the constitutively active orphan G protein coupled receptors, GPR26 and GPR78.
16389273 2006 Association analysis of the chromosome 4p-located G protein-coupled receptor 78 (GPR78) gene in bipolar affective disorder and schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.