Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.70
PubTator Score 7.50

Knowledge Summary

Patent (795)

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count P-value
lung adenocarcinoma 2716 3.7e-06
breast carcinoma 1638 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.400 3.0e-02
lung adenocarcinoma 1.700 3.7e-06

Gene RIF (5)

AA Sequence

MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDMPFTLLGVMRG      1 - 70
RTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRPRYAGLLLGCAWGQSLAFSGA     71 - 140
ALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVGFVLPLAVLCLTSLQVHRVARRHCQRMDTVT    141 - 210
MKALALLADLHPSVRQRCLIQQKRRRHRATRKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSK    211 - 280
CLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGS    281 - 350
VDTENDSCLQQTH                                                             351 - 363
//

Text Mined References (11)

PMID Year Title