Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.15
PubTator Score 14.05

Knowledge Summary

Patent (2,821)

Synonym

Accession Q96P66 Q5JSM8 Q8NG93
Symbols GPCR6
PAGH2

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (3)

PMID Text
26792934 Germline GPR101 mutations are very rare in patients with sporadic pituitary adenomas of various histotypes.
25470569 X-linked acrogigantism is caused by an Xq26.3 genomic duplication and is characterized by early-onset gigantism. Also found recurrent mutation in GPR101 in some adults with acromegaly.
24264576 GPR101 is a critical requirement for GnRH-(1-5) transactivation of EGFR in Ishikawa cells.

AA Sequence

MTSTCTNSTRESNSSHTCMPLSKMPISLAHGIIRSTVLVIFLAASFVGNIVLALVLQRKPQLLQVTNRFI      1 - 70
FNLLVTDLLQISLVAPWVVATSVPLFWPLNSHFCTALVSLTHLFAFASVNTIVVVSVDRYLSIIHPLSYP     71 - 140
SKMTQRRGYLLLYGTWIVAILQSTPPLYGWGQAAFDERNALCSMIWGASPSYTILSVVSFIVIPLIVMIA    141 - 210
CYSVVFCAARRQHALLYNVKRHSLEVRVKDCVENEDEEGAEKKEEFQDESEFRRQHEGEVKAKEGRMEAK    211 - 280
DGSLKAKEGSTGTSESSVEARGSEEVRESSTVASDGSMEGKEGSTKVEENSMKADKGRTEVNQCSIDLGE    281 - 350
DDMEFGEDDINFSEDDVEAVNIPESLPPSRRNSNSNPPLPRCYQCKAAKVIFIIIFSYVLSLGPYCFLAV    351 - 420
LAVWVDVETQVPQWVITIIIWLFFLQCCIHPYVYGYMHKTIKKEIQDMLKKFFCKEKPPKEDSHPDLPGT    421 - 490
EGGTEGKIVPSYDSATFP                                                        491 - 508
//

Text Mined References (12)

PMID Year Title
26792934 2016 Very low frequency of germline GPR101 genetic variation and no biallelic defects with AIP in a large cohort of patients with sporadic pituitary adenomas.
25470569 2014 Gigantism and acromegaly due to Xq26 microduplications and GPR101 mutation.
24264576 2014 GnRH-(1-5) transactivates EGFR in Ishikawa human endometrial cells via an orphan G protein-coupled receptor.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
21438024 2011 Methyl-CpG binding column-based identification of nine genes hypermethylated in colorectal cancer.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...