Property Summary

Ligand Count 9
NCBI Gene PubMed Count 9
PubMed Score 25.69
PubTator Score 13.76

Knowledge Summary

Patent (5,283)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.3e-21
atypical teratoid / rhabdoid tumor 5112 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 1.8e-02
lung carcinoma 3.300 1.3e-21

Gene RIF (4)

AA Sequence

MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNALVFYVV      1 - 70
TRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIA     71 - 140
VERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVH    141 - 210
QKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVA    211 - 280
LFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYC    281 - 350
IVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE    351 - 420
LAENSPLDSGH                                                               421 - 431
//

Text Mined References (9)

PMID Year Title