Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.48
PubTator Score 13.76

Knowledge Summary

Patent (5,283)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 0.018
lung carcinoma 3.300 0.000

Synonym

Accession Q96P65
Symbols AQ27
GPR103
SP9155

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity

Gene RIF (4)

PMID Text
26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
20534693 Results suggest that GPR103b and QRFP work in an autocrine/paracrine manner to regulate adipogenesis.
16648250 QRFP and GPR103A/B may regulate diverse neuroendocrine and behavioral functions and implicate this neuropeptide system in metabolic syndrome
12714592 characterization and tissue distribution of SP9155 (GPR103) ligand

AA Sequence

MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNALVFYVV      1 - 70
TRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIA     71 - 140
VERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVH    141 - 210
QKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVA    211 - 280
LFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYC    281 - 350
IVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE    351 - 420
LAENSPLDSGH                                                               421 - 431
//

Text Mined References (9)

PMID Year Title
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
20534693 2010 GPR103b functions in the peripheral regulation of adipogenesis.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16648250 2006 A neuropeptide ligand of the G protein-coupled receptor GPR103 regulates feeding, behavioral arousal, and blood pressure in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12960173 2003 A new peptidic ligand and its receptor regulating adrenal function in rats.
12714592 2003 Identification and characterization of a novel RF-amide peptide ligand for orphan G-protein-coupled receptor SP9155.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.