Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
Funding $252,968.33
PubMed Score 19.90
PubTator Score 9.06

Knowledge Summary

Patent (4,542)

TINX Plot

  Disease Relevance (47)

Disease Z-score Confidence
Male infertility 170 4.741 2.4
Infertility 163 4.035 2.0
Congenital dyserythropoietic anemia 17 3.335 1.7
Sensorineural hearing loss 107 3.223 1.6
Nonsyndromic deafness 121 3.06 1.5
Amenorrhea Secondary to Ovarian Dysfunct... 8 
Aorta Dextratransposition with Intact Ve... 6 
Atrophic vaginitis 14
Cervical ripening procedure 9
Coarctation of aorta 6
Congenital Heart Defect Requiring Open P... 6 
Congenital atresia of the pulmonary valv... 6 
Congenital atresia of tricuspid valve 6
Contraception 15
Corpus Luteum Insufficiency Syndrome 8
Deafness, Sensorineural, And Male Infert... 2 
Dysfunctional uterine bleeding 9
Ebstein's anomaly of tricuspid valve 6
Endometrial Hyperplasia Prevention 9
Endometrial carcinoma 18
Endometriosis 535
Hydatidiform mole, benign 9
Impotence 45
Incomplete miscarriage 10
Induction of labor 10
Infertility Secondary to Progesterone De... 8 
Menopausal flushing 17
Postmenopausal osteoporosis 19
Pregnancy with abortive outcome 12
Prevention of Premature Labor 9
Pulmonary artery stenosis 6
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 9
Tetralogy of Fallot 35
active ulcerative colitis 477
atypical teratoid / rhabdoid tumor 4,369
glioblastoma 5,572
head and neck cancer 270
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (13)

Gene RIF (3)

PMID Text
23519396 Levels of Tektin 2 and CatSper 2 proteins are positively associated with sperm motility parameters. Measurements of Tektin 2 levels can be correlated with the clinical outcome of ICSI.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16740636 CatSper1 and CatSper2 can associate with and modulate the function of the Ca(v)3.3 channel, which might be important in the regulation of sperm function.

AA Sequence

MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK      1 - 70
PQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFLNTIILMVEIELLESTNTKLW     71 - 140
PLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVFDFVVTMLSLLPEVVVLVGVTGQSVWLQLLR    141 - 210
ICRVLRSLKLLAQFRQIQIIILVLVRALKSMTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFF    211 - 280
SDLPNSLVTVFILFTLDHWYALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKE    281 - 350
LNEEMARREVQLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE    351 - 420
EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPGLMEMDQDDRV    421 - 490
WPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK                                  491 - 530
//

Text Mined References (17)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
23519396 2013 Levels of Tektin 2 and CatSper 2 in normozoospermic and oligoasthenozoospermic men and its association with motility, fertilization rate, embryo quality and pregnancy rate.
21412339 2011 Progesterone activates the principal Ca2+ channel of human sperm.
21412338 2011 The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17347248 2007 Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17098888 2007 Sensorineural deafness and male infertility: a contiguous gene deletion syndrome.
16740636 2006 Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity.
More...