Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
Funding $252,968.33
PubMed Score 19.90
PubTator Score 9.06

Knowledge Summary

Patent (4,542)

Expression

  Differential Expression (13)

Gene RIF (3)

PMID Text
23519396 Levels of Tektin 2 and CatSper 2 proteins are positively associated with sperm motility parameters. Measurements of Tektin 2 levels can be correlated with the clinical outcome of ICSI.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16740636 CatSper1 and CatSper2 can associate with and modulate the function of the Ca(v)3.3 channel, which might be important in the regulation of sperm function.

AA Sequence

MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK      1 - 70
PQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFLNTIILMVEIELLESTNTKLW     71 - 140
PLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVFDFVVTMLSLLPEVVVLVGVTGQSVWLQLLR    141 - 210
ICRVLRSLKLLAQFRQIQIIILVLVRALKSMTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFF    211 - 280
SDLPNSLVTVFILFTLDHWYALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKE    281 - 350
LNEEMARREVQLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE    351 - 420
EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPGLMEMDQDDRV    421 - 490
WPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK                                  491 - 530
//

Publication (17)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
23519396 2013 Levels of Tektin 2 and CatSper 2 in normozoospermic and oligoasthenozoospermic men and its association with motility, fertilization rate, embryo quality and pregnancy rate.
21412339 2011 Progesterone activates the principal Ca2+ channel of human sperm.
21412338 2011 The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17347248 2007 Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17098888 2007 Sensorineural deafness and male infertility: a contiguous gene deletion syndrome.
16740636 2006 Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity.
More...