Property Summary

NCBI Gene PubMed Count 10
Grant Count 1,244
R01 Count 263
Funding $276,245,287.01
PubMed Score 6461.33
PubTator Score 121.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
chronic lymphosyte leukemia -1.200 0.000

Synonym

Accession Q96P53 B1AL86 Q96CS1
Symbols PROF
WDF2
ZFYVE22

Gene

Gene RIF (4)

PMID Text
24675677 CDKN2D-WDFY2 fusion could be an important molecular signature for understanding and classifying sub-lineages among heterogeneous high-grade serous ovarian carcinomas.
17313651 presence of ProF increases the PKCzeta-dependent phosphorylation of VAMP2 in vitro
16873553 WDFY2, the WD40 and FYVE domain containing protein 2, has roles in endocytosis
16792529 The ProF protein partially co-localizes with EEA1 on vesicular structures and binds to the protein kinases Akt and PKCzeta/lambda (protein kinase Czeta/lambda) via its WD-repeat propeller.

AA Sequence

MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSP      1 - 70
CSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAW     71 - 140
HCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPV    141 - 210
QRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPE    211 - 280
WLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEA    281 - 350
ITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS                        351 - 400
//

Publication (11)

PMID Year Title
24675677 2014 CDKN2D-WDFY2 is a cancer-specific fusion gene recurrent in high-grade serous ovarian carcinoma.
18388859 2008 Akt- and Foxo1-interacting WD-repeat-FYVE protein promotes adipogenesis.
17313651 2007 WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16873553 2006 The WD40 and FYVE domain containing protein 2 defines a class of early endosomes necessary for endocytosis.
16792529 2006 A WD-FYVE protein binds to the kinases Akt and PKCzeta/lambda.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...