Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.90
PubTator Score 4.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.200 1.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.814 4.4e-03
colon cancer -2.400 3.4e-05
cutaneous lupus erythematosus -1.500 2.2e-03
cystic fibrosis -1.300 5.7e-03
Duchenne muscular dystrophy 1.382 1.1e-05
ependymoma 1.500 1.3e-03
intraductal papillary-mucinous carcinoma... -3.100 3.2e-05
intraductal papillary-mucinous neoplasm ... -3.000 1.1e-03
invasive ductal carcinoma -1.300 5.0e-03
juvenile dermatomyositis 1.322 3.7e-07
lung cancer -3.100 5.4e-06
ovarian cancer -2.200 1.2e-08
psoriasis -2.100 7.9e-09
sonic hedgehog group medulloblastoma 2.600 7.2e-05

Gene RIF (2)

AA Sequence

MAHYITFLCMVLVLLLQNSVLAEDGEVRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWLVNITKNFDIG      1 - 70
PKFIQVGVVQYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLFAKSSRFLTKIAV     71 - 140
VLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMKQK    141 - 210
LCEESVCPTRIPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPS    211 - 280
YVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKILLFTTTSVINGSQVVTFANPQVKTLFDEGWH    281 - 350
QIRLLVTEQDVTLYIDDQQIENKPLHPVLGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA    351 - 420
CEIPGFNGECLNGPSDVGSTPAPCICPPGKPGLQGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVP    421 - 490
GSPGIQGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAG    491 - 560
FPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGK    561 - 630
KGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMGLPGIQGKKGDK    631 - 700
GNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGPKGQPG    701 - 770
DPGPQGPPGLDGKPGREFSEQFIRQVCTDVIRAQLPVLLQSGRIRNCDHCLSQHGSPGIPGPPGPIGPEG    771 - 840
PRGLPGLPGRDGVPGLVGVPGRPGVRGLKGLPGRNGEKGSQGFGYPGEQGPPGPPGPEGPPGISKEGPPG    841 - 910
DPGLPGKDGDHGKPGIQGQPGPPGICDPSLCFSVIARRDPFRKGPNY                           911 - 957
//

Text Mined References (16)

PMID Year Title