Property Summary

NCBI Gene PubMed Count 80
Grant Count 8
R01 Count 5
Funding $1,766,995
PubMed Score 68.92
PubTator Score 103.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.853 0.000
interstitial cystitis 3.700 0.005
primary Sjogren syndrome 2.700 0.000
nasopharyngeal carcinoma -1.500 0.019
ductal carcinoma in situ 1.300 0.043
ulcerative colitis 1.900 0.008
psoriasis 2.400 0.000

Gene RIF (93)

PMID Text
26994388 CTLA4 and FCRL3 genes overexpression may play an important role in children suffering from autoimmune thyroiditis.
26746625 genetic polymorphism is associated with rheumatoid arthritis in Chinese Han population
26402798 4 Single Nucleotide Polymorphisms (rs7528684, rs945635, rs3761959, and rs2282284) could significantly elevate the risk of Neuromyelitis Optica in Chinese Han population.
26334889 FCRL3 genetic polymorphisms were associated with an increased risk of endometriosis-related infertility, regardless of symptoms.
26321232 FCRL3_3, FCRL3_5 and FCRL3_6 polymorphisms could increase susceptibility to Graves' disease only in Asians, rather than in Caucasians.
26051414 Association between FCRL3 polymorphisms and increased risk of sudden sensorineural hearing loss in a Chinese Han population.
25762785 the TIGIT/FCRL3 combination allows reliable identification of Helios(+) Treg cells even in highly activated conditions in vitro as well as in PBMCs of autoimmune patients.
25594855 study found a significant association between the SNPs in FCRL3 gene and allergic rhinitis (AR) in Chinese Han patients; results suggest these gene polymorphisms might be the autoimmunity risk for AR
25575677 Genetic polymorphisms in FCRL3 are genetic risk factors for neuromyelitis optica in the Chinese population.
24593204 CONCLUSIONS: Our study demonstrated that the FCRL3 -169T>C polymorphism is not a risk factor of systemic lupus erythematosus in the Polish population, but this polymorphism may contribute to autoantibody production in this disease.
More...

AA Sequence

MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHD      1 - 70
KIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQL     71 - 140
PNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLT    141 - 210
CETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRV    211 - 280
QRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKE    281 - 350
SDAGRYYCAADNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE    351 - 420
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTLRAPGAQAVVG    421 - 490
DLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTL    491 - 560
NVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARARRKPGGLSATGTSSHSPSECQEPSSSRPSRI    561 - 630
DPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHP    631 - 700
DDSAGEASSRGRAHEEDDEENYENVPRVLLASDH                                        701 - 734
//

Text Mined References (85)

PMID Year Title
26994388 2016 In children with autoimmune thyroiditis CTLA4 and FCRL3 genes--but not PTPN22--are overexpressed when compared to adults.
26746625 2016 FCRL3 gene polymorphisms as risk factors for rheumatoid arthritis.
26402798 2015 The Fc Receptor-Like 3 Polymorphisms (rs7528684, rs945635, rs3761959 and rs2282284) and The Risk of Neuromyelitis Optica in A Chinese Population.
26334889 2015 Association of FCRL3 Genetic Polymorphisms With Endometriosis-Related Infertility Risk: An Independent Study in Han Chinese.
26321232 2016 Genetic association of Fc receptor-like glycoprotein with susceptibility to Graves' disease in a Chinese Han population.
26051414 2015 FCRL3 gene polymorphisms confer risk for sudden sensorineural hearing loss in a Chinese Han Population.
25762785 2015 Coexpression of TIGIT and FCRL3 identifies Helios+ human memory regulatory T cells.
25594855 2015 FCRL3 gene polymorphisms confer autoimmunity risk for allergic rhinitis in a Chinese Han population.
25575677 2016 Significant Association Between Fc Receptor-Like 3 Polymorphisms (-1901A>G and -658C>T) and Neuromyelitis Optica (NMO) Susceptibility in the Chinese Population.
24593204 2014 The FCRL3 -169T>C polymorphism might be associated with some autoantibody presence in patients with SLE in a Polish population.
More...