Property Summary

NCBI Gene PubMed Count 85
PubMed Score 70.82
PubTator Score 103.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ 1.300 4.3e-02
interstitial cystitis 3.700 4.6e-03
nasopharyngeal carcinoma -1.500 1.9e-02
non primary Sjogren syndrome sicca -1.400 2.4e-02
osteosarcoma -1.343 1.2e-04
psoriasis 2.400 1.1e-30
ulcerative colitis 1.900 8.5e-03

Gene RIF (97)

AA Sequence

MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHD      1 - 70
KIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQL     71 - 140
PNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLT    141 - 210
CETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRV    211 - 280
QRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKE    281 - 350
SDAGRYYCAADNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE    351 - 420
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTLRAPGAQAVVG    421 - 490
DLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTL    491 - 560
NVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARARRKPGGLSATGTSSHSPSECQEPSSSRPSRI    561 - 630
DPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHP    631 - 700
DDSAGEASSRGRAHEEDDEENYENVPRVLLASDH                                        701 - 734
//

Text Mined References (90)

PMID Year Title