Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $81,149
PubMed Score 77.91
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q96P26 B5MCR0 B7ZVX7 Q53RX2 Q8N9W3 Q8NA26 Q96DU5 Q96KE6 Q96M25 Q96SA3 cN1B
Symbols AIRP
CN1B
CN-IB

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
20392501 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAE      1 - 70
GTALGPCHTIRIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQWSRISRSPSTKAPSIDEPRS     71 - 140
RNTSAKLPSSSTSSRTPSTSPSLHDSSPPPLSGQPSLQPPASPQLPRSLDSRPPTPPEPDPGSRRSTKMQ    141 - 210
ENPEAWAQGIVREIRQTRDSQPLEYSRTSPTEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEA    211 - 280
AYWASMRSFYEKNPSCSRPWPPKPKNAITIALSSCALFNMVDGRKIYEQEGLEKYMEYQLTNENVILTPG    281 - 350
PAFRFVKALQYVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKDPIGYLK    351 - 420
AYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHFTKEHGLDKFF    421 - 490
QYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEID    491 - 560
EALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRLGSIAAYGFNKKFSS                        561 - 610
//

Text Mined References (10)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11690631 2001 Cloning of a mouse cytosolic 5'-nucleotidase-I identifies a new gene related to human autoimmune infertility-related protein.