Property Summary

Ligand Count 2
NCBI Gene PubMed Count 474
PubMed Score 1936.56
PubTator Score 1402.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Atherosclerosis 291 3.903 2.0
Disease Target Count Z-score Confidence
CINCA Syndrome 2 0.0 5.0
Disease Target Count Z-score Confidence
Amyloidosis 67 4.127 2.1

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.600 6.5e-03
Bipolar Disorder 2.365 3.9e-02
cutaneous lupus erythematosus 1.300 3.3e-02
cystic fibrosis 1.624 2.6e-03
gastric cancer -1.600 1.7e-03
invasive ductal carcinoma 1.946 1.7e-02
malignant mesothelioma -1.400 1.2e-06
non-small cell lung cancer -1.139 1.1e-12
osteosarcoma -2.622 1.0e-05
pancreatic cancer -1.200 1.0e-02
pancreatic carcinoma -1.200 1.0e-02
Rheumatoid arthritis 1.600 3.5e-02
ulcerative colitis 1.200 1.6e-02

Gene RIF (462)

AA Sequence

MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAM      1 - 70
AVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKY     71 - 140
RKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFD    141 - 210
PDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCC    211 - 280
PDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITT    281 - 350
RPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT    351 - 420
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLR    421 - 490
NHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTV    491 - 560
LLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKLQIQPSQLEL    561 - 630
FYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRH    631 - 700
LDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGC    701 - 770
NIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT    771 - 840
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLST    841 - 910
NQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNND    911 - 980
LGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW                  981 - 1036
//

Text Mined References (483)

PMID Year Title