Property Summary

NCBI Gene PubMed Count 379
Grant Count 472
R01 Count 266
Funding $48,166,978.76
PubMed Score 1655.72
PubTator Score 1402.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 3.000 0.009
gastric cancer -1.600 0.002
pancreatic cancer -1.200 0.010
malignant mesothelioma -1.400 0.000
cutaneous lupus erythematosus 1.300 0.033
osteosarcoma -2.622 0.000
cystic fibrosis 1.624 0.003
non-small cell lung cancer -1.139 0.000
lung cancer -1.800 0.000
pancreatic carcinoma -1.200 0.010
invasive ductal carcinoma 1.946 0.017
Bipolar Disorder 2.365 0.039
ulcerative colitis 1.200 0.016

Synonym

Accession Q96P20 A0A024R5Q0 B2RC97 B7ZKS9 B7ZKT2 B7ZKT3 O75434 Q17RS2 Q59H68 Q5JQS8 Q5JQS9 Q6TG35 Q8TCW0 Q8TEU9 Q8WXH9
Symbols AII
AVP
FCU
MWS
FCAS
CIAS1
FCAS1
NALP3
C1orf7
CLR1.1
PYPAF1
AGTAVPRL

Gene

PDB

2NAQ   3QF2  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2825 screening 1296 / 0 / 329184 uHTS Luminescent assay for identification of inhibitors of NALP3 in yeast
2832 summary 0 / 0 / 0 Summary assay for identification of inhibitors of NALP3 in yeast
435006 screening 1091 / 0 / 255 Single concentration confirmation of uHTS for the identification of inhibitors of NALP3 in yeast using a luminescent assay
488784 screening 695 / 0 / 351 Single concentration confirmation of inhibitors of NALP3 in yeast using a Caspase-1-ASC counter screen
488794 screening 551 / 0 / 494 Single concentration confirmation of uHTS for the identification of inhibitors of NALP3 in yeast using a luminescent assay - retest
488799 confirmatory 65 / 0 / 4 Dose Response confirmation of uHTS for the identification of inhibitors of NALP3 in yeast using a luminescent assay
488800 confirmatory 66 / 0 / 1 Dose Response confirmation of inhibitors of NALP3 in yeast using a Caspase-1-ASC counter screen

Gene RIF (371)

PMID Text
27455015 NLRP3 gene rs10754558 polymorphisms are associated with increased risk of metabolic syndrome
27313051 these results demonstrate that NLRP3 inflammasome activity is not confined to "innate immune cells" but is an integral component of normal adaptive T(H)1 responses.
26972847 While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production.
26968633 NLRP3 expression, and not the inflammasome activation, is required for epithelial-mesenchymal transition in colorectal cancer cells.
26939933 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease
26865721 role of the influenza virus NS1 protein in activating the NLRP3 inflammasome
26782387 we propose that the NLRP3 rs10754558 polymorphism contributes to the development of type 2 diabetes mellitus but that rs7512998 and rs12137901 variants are not associated with susceptibility to this disease.
26760997 In patients with Age-Related Macular Degeneration increased mRNA levels of NLRP3 are observed.
26698881 Data suggest that Hepacivirus (HCV) activates hepatocyte NLRP3 inflammasomes, induces lipogenic enzymes/lipid droplet formation, and up-regulates transport of SREBF1/SREBF2/SCAP from ER to Golgi where SREBPs undergo proteolytic activation by S1P/S2P.
26662437 we found no significant association between NALP3 gene polymorphisms and the risk of primary gout.
More...

AA Sequence

MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAM      1 - 70
AVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKY     71 - 140
RKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFD    141 - 210
PDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCC    211 - 280
PDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITT    281 - 350
RPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT    351 - 420
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLR    421 - 490
NHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTV    491 - 560
LLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKLQIQPSQLEL    561 - 630
FYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRH    631 - 700
LDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGC    701 - 770
NIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT    771 - 840
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLST    841 - 910
NQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNND    911 - 980
LGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW                  981 - 1036
//

Text Mined References (387)

PMID Year Title
27455015 2016 [Association of NLRP3 gene single nucleotide polymorphisms with metabolic syndrome].
27313051 2016 T helper 1 immunity requires complement-driven NLRP3 inflammasome activity in CD4? T cells.
26972847 2016 IL-1 receptor antagonist ameliorates inflammasome-dependent inflammation in murine and human cystic fibrosis.
26968633 2016 Inflammasome-independent NLRP3 is required for epithelial-mesenchymal transition in colon cancer cells.
26939933 2016 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease.
26865721 2016 The RNA- and TRIM25-Binding Domains of Influenza Virus NS1 Protein Are Essential for Suppression of NLRP3 Inflammasome-Mediated Interleukin-1? Secretion.
26782387 2015 Investigation into the association between NLRP3 gene polymorphisms and susceptibility to type 2 diabetes mellitus.
26760997 2016 NLRP3 Upregulation in Retinal Pigment Epithelium in Age-Related Macular Degeneration.
26698881 2016 The Hepatitis C Virus-induced NLRP3 Inflammasome Activates the Sterol Regulatory Element-binding Protein (SREBP) and Regulates Lipid Metabolism.
26662437 2015 Investigation on the association between NLRP3 gene polymorphisms and susceptibility to primary gout.
More...