Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
urothelial carcinoma -2.600 0.000
interstitial cystitis -1.200 0.011
nasopharyngeal carcinoma -2.400 0.000
chronic rhinosinusitis -2.293 0.021
cystic fibrosis and chronic rhinosinusit... -3.035 0.016
psoriasis 2.500 0.000

Gene RIF (3)

PMID Text
22393410 SERPINB11 is a gene under selection on standing variation, with roles in host-pathogen interactions
22289513 SERPINB11 has a role in ovarian endometrioid carcinoma in chickens and human
17562709 SERPINB11 is a new noninhibitory intracellular serpin

AA Sequence

MGSLSTANVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETAEQLEKVLHFSHTVDSLKPG      1 - 70
FKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQ     71 - 140
STEETRKMINAWVENKTNGKVANLFGKSTIDPSSVMVLVNIIYFKGQRQNKFQVRETVKSPFQLSEGKNV    141 - 210
TVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMER    211 - 280
EVEVHLPRFKLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAAT    281 - 350
GDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP                                351 - 392
//

Text Mined References (10)

PMID Year Title
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
22393410 2012 Loss and gain of function in SERPINB11: an example of a gene under selection on standing variation, with implications for host-pathogen interactions.
22289513 2012 Avian SERPINB11 gene: a marker for ovarian endometrioid cancer in chickens.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17562709 2007 SERPINB11 is a new noninhibitory intracellular serpin. Common single nucleotide polymorphisms in the scaffold impair conformational change.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.