Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -2.293 2.1e-02
cystic fibrosis and chronic rhinosinusit... -3.035 1.6e-02
interstitial cystitis -1.200 1.1e-02
nasopharyngeal carcinoma -2.400 3.9e-07
psoriasis 2.500 3.9e-18
urothelial carcinoma -2.600 2.3e-05

Gene RIF (3)

AA Sequence

MGSLSTANVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETAEQLEKVLHFSHTVDSLKPG      1 - 70
FKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQ     71 - 140
STEETRKMINAWVENKTNGKVANLFGKSTIDPSSVMVLVNIIYFKGQRQNKFQVRETVKSPFQLSEGKNV    141 - 210
TVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMER    211 - 280
EVEVHLPRFKLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAAT    281 - 350
GDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP                                351 - 392
//

Text Mined References (10)

PMID Year Title