Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.40
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 0.000

Synonym

Accession Q96P11 B3KX04 B4DP79 G3V0G9 Q6ZUI8 Q96HT9 Q9NW70
Symbols NOL1
p120
NOL1R
NSUN5A
WBSCR20
WBSCR20A
p120(NOL1)

Gene

PDB

2B9E  

Gene RIF (1)

PMID Text
11978965 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome

AA Sequence

MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHL      1 - 70
AKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRV     71 - 140
NTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL    141 - 210
QDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCE    211 - 280
LAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPS    281 - 350
LQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVA    351 - 420
VIERVEVPR                                                                 421 - 429
//

Text Mined References (16)

PMID Year Title
23913415 2013 Yeast Nop2 and Rcm1 methylate C2870 and C2278 of the 25S rRNA, respectively.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...