Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.40
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 2.3e-09
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 4.236 2.1
Disease Target Count Z-score Confidence
Supravalvular aortic stenosis 12 3.589 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 2.3e-09

Gene RIF (1)

AA Sequence

MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHL      1 - 70
AKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRV     71 - 140
NTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL    141 - 210
QDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCE    211 - 280
LAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPS    281 - 350
LQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVA    351 - 420
VIERVEVPR                                                                 421 - 429
//

Text Mined References (16)

PMID Year Title