Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $3,571.43
PubMed Score 8.10
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Synonym

Accession Q96P09 Q6IPY1 Q96RW5
Symbols ILP2
ILP-2
hILP2

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

1XB0   1XB1  

Gene RIF (6)

PMID Text
25800559 Fumonisin B1 caused dose-dependent increase in BIRC-8/ILP-2 mRNA and protein expression in HepG2 cells to inhibit apoptosis.
24266799 increased expression with progression of chronic myeloid leukaemia
23222679 results indicate that ILP-2 is a novel breast cancer biomarker in the peripheral blood.
20800603 Observational study of gene-disease association. (HuGE Navigator)
15485395 ILP2 is an unstable protein, and cannot inhibit caspase 9 in a physiological way on its own; possibly ILP2 requires assistance from unidentified cellular factors to be an effective inhibitor of apoptosis in vivo
12372615 role in preventing shear-stress induced endothelial cell apoptosis via negative regulation of caspase-3

AA Sequence

MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLL      1 - 70
EEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSG     71 - 140
SNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTC    141 - 210
KQCAEAVDRCPMCSAVIDFKQRVFMS                                                211 - 236
//

Publication (12)

PMID Year Title
25800559 2015 Fumonisin B? inhibits apoptosis in HepG2 cells by inducing Birc-8/ILP-2.
24266799 2014 Differential expression of BIRC family genes in chronic myeloid leukaemia--BIRC3 and BIRC8 as potential new candidates to identify disease progression.
23222679 2012 Inhibitor of apoptosis protein-like protein-2 as a novel serological biomarker for breast cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485395 2005 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372615 2002 Induction of human inhibitor of apoptosis protein-2 by shear stress in endothelial cells.
More...