Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.09
PubTator Score 193.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.7e-12
ulcerative colitis 1819 1.1e-04
active Crohn's disease 922 1.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -2.651 1.4e-03
psoriasis -1.400 5.7e-12
ulcerative colitis -2.900 1.1e-04

Gene RIF (2)

AA Sequence

MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKL      1 - 70
LTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGP     71 - 140
EEDQDHIYHPQ                                                               141 - 151
//

Text Mined References (12)

PMID Year Title