Property Summary

NCBI Gene PubMed Count 10
Grant Count 590
R01 Count 377
Funding $56,085,107.96
PubMed Score 5.94
PubTator Score 193.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -2.651 0.001
ulcerative colitis -2.900 0.000
psoriasis -1.400 0.000

Synonym

Accession Q96NZ9 B7ZL57 B7ZL58 E9KL31 Q5VWY4 Q7Z4X5 Q8IWR3 Q8NCS2
Symbols UPA
PRO1195

Gene

Gene RIF (2)

PMID Text
24374861 PRAP1 is a protein interacting partner of MAD1 and that PRAP1 is able to down-regulate MAD1 and suppress mitotic checkpoint signalling in hepatocellular carcinoma.
23235459 Induction of PRAP1 expression by p53 in response to DNA-damaging agents contributes to cancer cell survival.

AA Sequence

MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKL      1 - 70
LTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGP     71 - 140
EEDQDHIYHPQ                                                               141 - 151
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24374861 2014 Proline-rich acidic protein 1 (PRAP1) is a novel interacting partner of MAD1 and has a suppressive role in mitotic checkpoint signalling in hepatocellular carcinoma.
23235459 2012 PRAP1 is a novel executor of p53-dependent mechanisms in cell survival after DNA damage.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20674898 2010 Uterine luminal epithelium-specific proline-rich acidic protein 1 (PRAP1) as a marker for successful embryo implantation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14583459 2003 The proline-rich acidic protein is epigenetically regulated and inhibits growth of cancer cell lines.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...