Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.16
PubTator Score 8.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Gene RIF (6)

PMID Text
23829672 Data suggest that myostatin binding to its receptor (activin receptors type II) can be blocked by WFIKKN1 but not WFIKKN2; various forms of myostatin (promyostatin, myostatin pro-domain, and latent/processed myostatin) bind WFIKKN1 but not WFIKKN2.
21054789 data indicate that WFIKKN proteins are antagonists of GDF8 and GDF11, but in the case of TGFbeta1, BMP2 and BMP4 they function as growth factor binding proteins
18596030 Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11.
16791741 three-dimensional structure of a Kunitz domain with a tryptophan residue at the P02 site of the protease-recognition loop
12709070 Data suggest that the physiological target of WFIKKN protein may be trypsin.
11928817 Newly discovered WFIKKNPR gene structure and tissue distribution of gene expression is commpared with that of the WFIKKN gene in adult and fetal tissues and organs.

AA Sequence

MPALRPLLPLLLLLRLTSGAGLLPGLGSHPGVCPNQLSPNLWVDAQSTCERECSRDQDCAAAEKCCINVC      1 - 70
GLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDIWDGQPVCRCRDRCEKEPSFTCASDGLTYYNRCY     71 - 140
MDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTARPTPGAAPVPPALYSSPSPQAVQVGGTASLHCDVS    141 - 210
GRPPPAVTWEKQSHQRENLIMRPDQMYGNVVVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSV    211 - 280
VQREPARDAAPSIPAPAECLPDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQA    281 - 350
CARGPGDACVLPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPPCRAC    351 - 420
RLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTKYLEVTLSGMDWACP    421 - 490
CPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQACELLNRFQD                491 - 548
//

Text Mined References (13)

PMID Year Title
23829672 2013 Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2.
21054789 2010 WFIKKN1 and WFIKKN2 bind growth factors TGF?1, BMP2 and BMP4 but do not inhibit their signalling activity.
18596030 2008 Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11.
16791741 2006 Second Kunitz-type protease inhibitor domain of the human WFIKKN1 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12709070 2003 Expression, purification and characterization of the second Kunitz-type protease inhibitor domain of the human WFIKKN protein.
12595574 2003 Regulation of myostatin in vivo by growth and differentiation factor-associated serum protein-1: a novel protein with protease inhibitor and follistatin domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...