Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.91
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.6e-03
group 3 medulloblastoma 1.500 2.5e-04
medulloblastoma, large-cell 1.400 6.6e-05
osteosarcoma 1.396 1.4e-05
psoriasis -2.100 8.1e-12

AA Sequence

MIESDTSSIMSGIIRNSGQNHHPSPQEYRLLATTSDDDLPGDLQSLSWLTAVDVPRLQQMASGRVDLGGP      1 - 70
CVPHPHPGALAGVADLHVGATPSPLLHGPAGMAPRGMPGLGPITGHRDSMSQFPVGGQPSSGLQDPPHLY     71 - 140
SPATQPQFPLPPGAQQCPPVGLYGPPFGVRPPYPQPHVAVHSSQELHPKHYPKPIYSYSCLIAMALKNSK    141 - 210
TGSLPVSEIYSFMKEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKMSGSSRKGCLWALNLARIDKMEE    211 - 280
EMHKWKRKDLAAIHRSMANPEELDKLISDRPESCRRPGKPGEPEAPVLTHATTVAVAHGCLAVSQLPPQP    281 - 350
LMTLSLQSVPLHHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINISTDMNTEVDA    351 - 420
LDPSIMDFALQGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQVTGLYTAYST    421 - 490
PDSVAASGTSSSSQYLGAQGNKPIALL                                               491 - 517
//

Text Mined References (8)

PMID Year Title