Property Summary

NCBI Gene PubMed Count 8
Grant Count 12
R01 Count 8
Funding $1,026,497.92
PubMed Score 18.79
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.396 0.000
atypical teratoid / rhabdoid tumor 1.100 0.002
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.400 0.000
psoriasis -2.100 0.000

AA Sequence

MIESDTSSIMSGIIRNSGQNHHPSPQEYRLLATTSDDDLPGDLQSLSWLTAVDVPRLQQMASGRVDLGGP      1 - 70
CVPHPHPGALAGVADLHVGATPSPLLHGPAGMAPRGMPGLGPITGHRDSMSQFPVGGQPSSGLQDPPHLY     71 - 140
SPATQPQFPLPPGAQQCPPVGLYGPPFGVRPPYPQPHVAVHSSQELHPKHYPKPIYSYSCLIAMALKNSK    141 - 210
TGSLPVSEIYSFMKEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKMSGSSRKGCLWALNLARIDKMEE    211 - 280
EMHKWKRKDLAAIHRSMANPEELDKLISDRPESCRRPGKPGEPEAPVLTHATTVAVAHGCLAVSQLPPQP    281 - 350
LMTLSLQSVPLHHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINISTDMNTEVDA    351 - 420
LDPSIMDFALQGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQVTGLYTAYST    421 - 490
PDSVAASGTSSSSQYLGAQGNKPIALL                                               491 - 517
//

Text Mined References (8)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
22323600 2012 Forkhead box N4 (Foxn4) activates Dll4-Notch signaling to suppress photoreceptor cell fates of early retinal progenitors.
16541075 2006 The finished DNA sequence of human chromosome 12.
15492871 2004 Characterization of human FOXN4 gene in silico.
15464224 2004 Expression of the winged helix/forkhead gene, foxn4, during zebrafish development.
15363391 2004 Foxn4 controls the genesis of amacrine and horizontal cells by retinal progenitors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.