Property Summary

NCBI Gene PubMed Count 56
Grant Count 95
R01 Count 64
Funding $10,243,433.71
PubMed Score 106.60
PubTator Score 67.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.905 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q96NY9 Q9H7D9
Symbols SLX3

Gene

PDB

2MC3   2ZIX   4P0P   4P0Q   4P0R   4P0S  

Gene RIF (59)

PMID Text
26804904 Avoiding damage formation through invalidation of Mus81-Eme2 and Mre11, or preventing damage signaling by turning off the ATM pathway, suppresses the replication phenotypes of Chk1-deficient cells.
26714930 Mus81 knockdown improves the chemosensitivity of HCC cells by inducing S-phase arrest and promoting apoptosis through CHK1 pathway, suggesting Mus81 as a novel therapeutic target for HCC.
26401039 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25879486 Mus81 regulates the rate of DNA replication during normal growth by promoting replication fork progression while reducing the frequency of replication initiation events.
25618414 Authors confirmed that HIV-1 Vpr induces degradation of Mus81 although, surprisingly, degradation is independent and genetically separable from Vprs ability to induce G2 arrest.
25618414 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25496524 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25496524 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25496524 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25496524 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
More...

AA Sequence

MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSGKEAKILQHFG      1 - 70
DGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGSYWPARHSGARV     71 - 140
ILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSARPWPALRSLLHRNLVLRTHQPARYSLTPEGL    141 - 210
ELAQKLAESEGLSLLNVGIGPKEPPGEETAVPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRG    211 - 280
GGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFR    281 - 350
EQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQ    351 - 420
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKA    421 - 490
AALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT             491 - 551
//

Text Mined References (62)

PMID Year Title
26804904 2016 Signaling from Mus81-Eme2-Dependent DNA Damage Elicited by Chk1 Deficiency Modulates Replication Fork Speed and Origin Usage.
26714930 2016 Mus81 knockdown improves chemosensitivity of hepatocellular carcinoma cells by inducing S-phase arrest and promoting apoptosis through CHK1 pathway.
25879486 2015 The DNA repair endonuclease Mus81 facilitates fast DNA replication in the absence of exogenous damage.
25618414 2015 Determinants for degradation of SAMHD1, Mus81 and induction of G2 arrest in HIV-1 Vpr and SIVagm Vpr.
25224045 2014 Identification and characterization of MUS81 point mutations that abolish interaction with the SLX4 scaffold protein.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24858046 2015 Cooperation of Blm and Mus81 in development, fertility, genomic integrity and cancer suppression.
24813886 2014 MUS81-EME2 promotes replication fork restart.
24733841 2014 Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
24692662 2014 Human MUS81-EME2 can cleave a variety of DNA structures including intact Holliday junction and nicked duplex.
More...