Property Summary

NCBI Gene PubMed Count 37
Grant Count 3
Funding $444,786
PubMed Score 99.56
PubTator Score 75.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96NY8 B4DQW3 Q96K15
Symbols LNIR
PRR4
EDSS1
PVRL4
nectin-4

Gene

PANTHER Protein Class (1)

PDB

4FRW   4GJT   4JJH  

Gene RIF (26)

PMID Text
27328518 Nectin-4 expression, when compared with control group, was higher in endometriotic lesions of patients having ovarian endometriosis and peritoneal endometriosis. This difference was significant in the endometrium of patients having endometriosis.
26949052 Nectin-4 is critical for gallbladder cancer cell progression via PI3K/AKT pathway activation of Rac1.
26617807 The data presented in this study suggested that nectin-4 may be a therapeutic target for systemic lupus erythematous through affecting the cell apoptosis
25926640 In airway epithelial cells, measles virus spread requires the nectin-4/afadin complex and is based on cytoplasm transfer between columnar cells.
25888293 Nectin-4 is a significant prognostic predictor, and may play a critical role in pancreatic cancer. Nectin-4 may be novel therapeutic target for pancreatic cancer.
25529316 The present study described clinical investigation of the EDSS1 identified in a large consanguineous family; DNA sequence analysis revealed a novel homozygous nonsense mutation (181C>T, p.Asp61*) in the PVRL4 gene.
25275122 Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25019423 Ovarian tissue expression and serum nectin 4 appear to be potential markers in ovarian cancer.
24577405 data outline a synergistic action of nectin-1 and -4 in the early steps of AJ formation and implicate this interaction in modulating the Rac1 signaling pathway
24335299 Ablation of nectin4 binding compromises CD46 usage by a hybrid vesicular stomatitis virus/measles virus.
More...

AA Sequence

MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARV      1 - 70
DAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQAR     71 - 140
LRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHL    141 - 210
VPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSY    211 - 280
NWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV    281 - 350
VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA    351 - 420
EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENG    421 - 490
TLRAKPTGNGIYINGRGHLV                                                      491 - 510
//

Text Mined References (40)

PMID Year Title
27328518 2016 The role of the adhesion molecule Nectin-4 in the pathogenesis of endometriosis.
26949052 2016 A novel PI3K/AKT signaling axis mediates Nectin-4-induced gallbladder cancer cell proliferation, metastasis and tumor growth.
26617807 2015 Down-regulation of nectin-4 inhibits apoptosis in systemic lupus erythematous (SLE) through targeting Bcl-2/Bax pathway.
25926640 2015 The Nectin-4/Afadin Protein Complex and Intercellular Membrane Pores Contribute to Rapid Spread of Measles Virus in Primary Human Airway Epithelia.
25888293 2015 Nectin-4 expression contributes to tumor proliferation, angiogenesis and patient prognosis in human pancreatic cancer.
25529316 2015 A novel homozygous nonsense mutation in the PVRL4 gene and expansion of clinical spectrum of EDSS1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25275122 2014 Different roles of the three loops forming the adhesive interface of nectin-4 in measles virus binding and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25019423 2014 The diagnostic efficacy of nectin 4 expression in ovarian cancer patients.
24577405 2014 Nectin-4 mutations causing ectodermal dysplasia with syndactyly perturb the rac1 pathway and the kinetics of adherens junction formation.
More...