Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.55
PubTator Score 4.16

Knowledge Summary

Patent (1,932)

Expression

Gene RIF (1)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEAGGGGPDRGPE      1 - 70
AEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGEPRGEAQREPEDSAAPERQEE     71 - 140
AEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSVEAEGRVGDSVDAEGPAGDSVDAEGPLGDNI    141 - 210
QAEGPAGDSVDAEGRVGDSVDAEGPAGDSVDAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSM    211 - 280
DAEGPAGRARRVSGEPQQSGDGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDA    281 - 350
RADAGEDRVGDGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE    351 - 420
GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYDGESIGNCPFS    421 - 490
QRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLG    491 - 560
TQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKALRKLDNYLNSPLPDEIDAYSTEDVTVSGRKF    561 - 630
LDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVA    631 - 700
KRMK                                                                      701 - 704
//

Text Mined References (13)

PMID Year Title
25058583 2014 Proteomic landscape of the human choroid-retinal pigment epithelial complex.
23535966 2013 Combined linkage analysis and exome sequencing identifies novel genes for familial goiter.
19863549 2010 Detailed molecular and clinical characterization of three patients with 21q deletions.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597386 2003 Identification of a novel member of the CLIC family, CLIC6, mapping to 21q22.12.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...