Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.70
PubTator Score 4.16

Knowledge Summary

Patent (1,932)

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.258 9.9e-03
Astrocytoma, Pilocytic 1.800 7.6e-04
atypical teratoid / rhabdoid tumor 1.800 4.6e-02
Breast cancer -1.100 3.3e-04
ependymoma 1.900 1.2e-03
gastric carcinoma -3.400 1.2e-02
group 4 medulloblastoma 1.500 1.8e-02
interstitial cystitis -1.200 1.1e-02
intraductal papillary-mucinous adenoma (... 1.700 1.2e-02
nasopharyngeal carcinoma -3.300 1.5e-10
osteosarcoma 1.275 4.1e-02
ovarian cancer 1.300 2.6e-02
pancreatic cancer 1.100 3.7e-02
pituitary cancer -1.900 5.5e-04
primary pancreatic ductal adenocarcinoma 1.201 1.9e-02
urothelial carcinoma -4.000 3.9e-02

Gene RIF (1)

AA Sequence

MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEAGGGGPDRGPE      1 - 70
AEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGEPRGEAQREPEDSAAPERQEE     71 - 140
AEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSVEAEGRVGDSVDAEGPAGDSVDAEGPLGDNI    141 - 210
QAEGPAGDSVDAEGRVGDSVDAEGPAGDSVDAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSM    211 - 280
DAEGPAGRARRVSGEPQQSGDGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDA    281 - 350
RADAGEDRVGDGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE    351 - 420
GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYDGESIGNCPFS    421 - 490
QRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLG    491 - 560
TQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKALRKLDNYLNSPLPDEIDAYSTEDVTVSGRKF    561 - 630
LDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVA    631 - 700
KRMK                                                                      701 - 704
//

Text Mined References (13)

PMID Year Title