Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.60
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-02
astrocytic glioma -1.800 3.8e-02
Astrocytoma, Pilocytic -1.300 3.1e-04
glioblastoma -1.100 2.8e-03
lung carcinoma 2.700 2.0e-26
medulloblastoma, large-cell -1.700 1.6e-02
oligodendroglioma -1.300 2.4e-07
Pick disease -1.400 1.1e-02
sonic hedgehog group medulloblastoma 1.800 1.0e-02

Gene RIF (6)

AA Sequence

MAVSASPVISATSSGAGVPGGLFRAEPLYSTPREPPRLTPNMINSFVVNNHSNSAGGGGRGNTNTNECRM      1 - 70
VDMHGMKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPG     71 - 140
VNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLI    141 - 210
TPTGITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQH    211 - 280
GIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMA    281 - 350
AAAQIHSPLSRAGTSVIKERIPESPSPAPSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQI    351 - 420
PIMKSPLDKIQLTPGQALPAGFPGPFIFADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLE    421 - 490
LYREREIRENLERQLAVELQSRTTMQKRLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRML    491 - 560
KDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQQLYSA                                   561 - 599
//

Text Mined References (14)

PMID Year Title