Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 8
Funding $457,783.83
PubMed Score 8.59
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 0.038
glioblastoma multiforme -1.900 0.000
oligodendroglioma -1.300 0.000
medulloblastoma, large-cell -1.700 0.016
pediatric high grade glioma -1.200 0.003
pilocytic astrocytoma -1.200 0.000
sonic hedgehog group medulloblastoma 1.800 0.010
lung carcinoma 2.700 0.000
Pick disease -1.400 0.011

Gene RIF (6)

PMID Text
25744029 DACH2 is an independent prognostic marker that can be used at initial diagnosis of urothelial carcinoma of the bladder to identify patients who have a high potential to develop metastasis.
25234129 Exome sequencing in two brothers with distinct phenotype including congenital language disorder, growth retardation, intellectual disability and urinary and fecal incontinence, identifies missense mutations in ABCD1 and DACH2.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15459172 Observational study of gene-disease association. (HuGE Navigator)
12438735 Most X;autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts a gene, DACH2.

AA Sequence

MAVSASPVISATSSGAGVPGGLFRAEPLYSTPREPPRLTPNMINSFVVNNHSNSAGGGGRGNTNTNECRM      1 - 70
VDMHGMKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPG     71 - 140
VNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLI    141 - 210
TPTGITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQH    211 - 280
GIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMA    281 - 350
AAAQIHSPLSRAGTSVIKERIPESPSPAPSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQI    351 - 420
PIMKSPLDKIQLTPGQALPAGFPGPFIFADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLE    421 - 490
LYREREIRENLERQLAVELQSRTTMQKRLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRML    491 - 560
KDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQQLYSA                                   561 - 599
//

Text Mined References (14)

PMID Year Title
25744029 2015 Prospective validation of DACH2 as a novel biomarker for prediction of metastasis and prognosis in muscle-invasive urothelial carcinoma of the bladder.
25234129 2014 Exome sequencing identifies mutations in ABCD1 and DACH2 in two brothers with a distinct phenotype.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15885503 2005 In vivo characterization of a vertebrate ultraconserved enhancer.
15772651 2005 The DNA sequence of the human X chromosome.
15459172 2004 Mutation analysis of two candidate genes for premature ovarian failure, DACH2 and POF1B.
More...