Property Summary

Ligand Count 1
NCBI Gene PubMed Count 12
PubMed Score 4.18
PubTator Score 4.16

Knowledge Summary

Patent (1,152)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 2.7e-02
Astrocytoma, Pilocytic -1.500 2.2e-03
ependymoma -1.900 2.0e-03
glioblastoma -1.100 2.7e-02
group 3 medulloblastoma -2.000 1.6e-02
lung carcinoma 1.800 7.8e-20
malignant mesothelioma -1.100 4.9e-05
oligodendroglioma -1.400 1.8e-02
ovarian cancer 1.200 4.3e-07
Pick disease -1.300 2.7e-02
primitive neuroectodermal tumor -1.400 2.3e-02

Gene RIF (6)

AA Sequence

MGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIA      1 - 70
VLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIV     71 - 140
HRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITY    141 - 210
ILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWIDGN    211 - 280
TALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPPETQASETSRPSS    281 - 350
PEITITEAPVLDHSVALPALTQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCS    351 - 420
SCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM                  421 - 476
//

Text Mined References (13)

PMID Year Title