Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.18
PubTator Score 4.16

Knowledge Summary

Patent (1,152)

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytoma -1.500 0.000
ependymoma -1.900 0.002
oligodendroglioma -1.400 0.018
glioblastoma multiforme -1.500 0.000
group 3 medulloblastoma -2.000 0.016
primitive neuroectodermal tumor -1.400 0.023
pilocytic astrocytoma -1.500 0.003
lung carcinoma 1.800 0.000
Pick disease -1.300 0.027
ovarian cancer 1.200 0.000

Synonym

Accession Q96NX5 Q86UH5 Q9Y3J7
Symbols VWS1
CLICK3
CLICKIII
dJ272L16.1

Gene

PDB

2JAM  

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
25677198 No evidence of association between polymorphisms in CAMK1G and sporadic amyotrophic lateral sclerosis in Han Chinese
23624525 Two new susceptibility loci for amyotrophic lateral sclerosis in the Han Chinese population in chromosome 1, CAMK1G and chromosome 22, SUSD2 and CABIN1.
20729199 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12637513 CLICK-III/CaMKIgamma is a novel membrane-anchored neuronal Ca2+/calmodulin-dependent protein kinase (CaMK).

AA Sequence

MGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIA      1 - 70
VLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIV     71 - 140
HRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITY    141 - 210
ILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWIDGN    211 - 280
TALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPPETQASETSRPSS    281 - 350
PEITITEAPVLDHSVALPALTQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCS    351 - 420
SCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM                  421 - 476
//

Text Mined References (13)

PMID Year Title
25677198 2015 No evidence of association between polymorphisms in four genes and sporadic amyotrophic lateral sclerosis in Han Chinese.
23624525 2013 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.
21935397 2011 Genome-wide population-based association study of extremely overweight young adults--the GOYA study.
20729199 2010 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...