Property Summary

NCBI Gene PubMed Count 26
Grant Count 38
R01 Count 35
Funding $2,501,175.56
PubMed Score 29.64
PubTator Score 18.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.500 0.001
ependymoma -3.900 0.000
oligodendroglioma -3.300 0.000
glioblastoma -4.500 0.000
osteosarcoma -1.416 0.000
medulloblastoma -3.000 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -3.900 0.006
primitive neuroectodermal tumor -3.100 0.005
adult high grade glioma -4.000 0.001
pilocytic astrocytoma -3.900 0.000
non primary Sjogren syndrome sicca -1.100 0.024
pituitary cancer 1.200 0.024
facioscapulohumeral dystrophy 1.800 0.001

Gene RIF (12)

PMID Text
26901794 The important role of this gene in the synapse and mental illness endophenotypes observed in animal models suggests that LRRC7 may play a role in susceptibility to bipolar disorder.
21784300 We found no genome-wide statistically significant associations but identified several plausible candidate genes among findings at p < 5E-05: LRRC7, TMEM132D, SEMA3A, ALK, and STIP1.
21610080 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17968527 common variants in LRRC7, KIRREL, NPHS2 and ACTN4 do not appeear to contribute to susceptibility to diabetic nephropathy in Finnish patients with type 1 diabetes
17968527 Observational study of gene-disease association. (HuGE Navigator)
17581699 Densin may associate with the cadherin-catenin and nephrin complex(es), and may be involved in the formation of the cell-cell contacts.
17039495 Densin is a novel testicular protein expressed in the cell membranes of Sertoli cells.
16741999 Densin can act as autoantigen, and autoantibodies against these can be detected in patients with type 1 diabetes.
12819232 expressed by glomerular podocytes and has a role in associating with the nephrin interacting protein complex at the slit diaphragm
More...

AA Sequence

MTTKRKIIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQA      1 - 70
LRKLSIPDNDLSNLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQLLNL     71 - 140
TQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFGELPEVLDQIQNLR    141 - 210
ELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTT    211 - 280
LKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCKNVTVM    281 - 350
SLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQR    351 - 420
VLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDENAGKVKDLSCQAPWERGQR    421 - 490
GITLQPARLSGDCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSMCTPLPVAAQSTTLPSLSGRQ    491 - 560
VEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSNPTANTEQTVKEKYEHKWPVAPKEITVEDSF    561 - 630
VHPANEMRIGELHPSLAETPLYPPKLVLLGKDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSGSS    631 - 700
NTRVKVGSLQTTAKDAVHNSLWGNRIAPSFPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTD    701 - 770
GSHYDNTGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSN    771 - 840
PWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDSNPNRSLSNVFS    841 - 910
QIHCRPESSKGVISISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLENYASGSDHLGSHER    911 - 980
PDKMLGPEHGMSSMSRSQSVPMLDDEMLTYGSSKGPQQQKASMTKKVYQFDQSFNPQGSVEVKAEKRIPP    981 - 1050
PFQHNPEYVQQASKNIAKDLISPRAYRGYPPMEQMFSFSQPSVNEDAVVNAQFASQGARAGFLRRADSLV   1051 - 1120
SATEMAMFRRVNEPHELPPTDRYGRPPYRGGLDRQSSVTVTESQFLKRNGRYEDEHPSYQEVKAQAGSFP   1121 - 1190
VKNLTQRRPLSARSYSTESYGASQTRPVSARPTMAALLEKIPSDYNLGNYGDKPSDNSDLKTRPTPVKGE   1191 - 1260
ESCGKMPADWRQQLLRHIEARRLDRNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDHQELPL   1261 - 1330
QKTPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQSLQHRSREQQPYEGNI   1331 - 1400
NKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYPEQFCVRIEKNPGLGFSISGGISGQGN   1401 - 1470
PFKPSDKGIFVTRVQPDGPASNLLQPGDKILQANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTV      1471 - 1537
//

Text Mined References (28)

PMID Year Title
26901794 2016 Genetic variant analysis of the putative regulatory regions of the LRRC7 gene in bipolar disorder.
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
22322875 2012 Genetic association of short sleep duration with hypertension incidence--a 6-year follow-up in the Korean genome and epidemiology study.
22072671 2011 Deletion of densin-180 results in abnormal behaviors associated with mental illness and reduces mGluR5 and DISC1 in the postsynaptic density fraction.
21784300 2011 Genome-wide association study of the child behavior checklist dysregulation profile.
21610080 2011 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...