Property Summary

Ligand Count 17
NCBI Gene PubMed Count 65
PubMed Score 177.13
PubTator Score 144.72

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -1.029 2.1e-03
group 3 medulloblastoma 1.100 6.4e-03
osteosarcoma 1.316 1.3e-04

 GWAS Trait (1)

Gene RIF (57)

AA Sequence

MKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP                                   421 - 459

Text Mined References (72)

PMID Year Title