Property Summary

Ligand Count 19
NCBI Gene PubMed Count 65
PubMed Score 177.13
PubTator Score 144.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -1.029 2.1e-03
group 3 medulloblastoma 1.100 6.4e-03
osteosarcoma 1.316 1.3e-04

 GWAS Trait (1)

Gene RIF (57)

AA Sequence

MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRS      1 - 70
ADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLH     71 - 140
VGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYAN    141 - 210
PFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITV    211 - 280
HFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFA    281 - 350
FATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNF    351 - 420
MKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP                                   421 - 459
//

Text Mined References (72)

PMID Year Title