Property Summary

NCBI Gene PubMed Count 62
Grant Count 23
R01 Count 21
Funding $4,220,191.17
PubMed Score 163.07
PubTator Score 144.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.316 0.000
adrenocortical carcinoma -1.029 0.002
group 4 medulloblastoma 1.300 0.000

Gene RIF (54)

PMID Text
26884338 A homology model of PCFT, based upon the Escherichia coliglycerol 3-phosphate transporter structure, predicted that PCFT transmembrane domains (TMDs) 1, 2, 7, and 11 form an extracellular gate in the inward-open conformation.
26193446 We conclude that SLC46A1/PCFT and SLC19A1/RFC-1 are associated with DFS of patients with colorectal cancer and hypothesize that poor response to 5-fluorouracil plus leucovorin therapy in some patients may be linked to low expression of these genes.
25877470 results imply that TMDs 3 and 6 provide critical interfaces for formation of hPCFT oligomers, which might be facilitated by the GXXXG motifs in TMD2 and TMD4.
25801697 Report sustained inhibition of PCFT by myricetin.
25697897 this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer.
25608532 The current study addresses the role of Tyr residues in SLC46A1 function; and identifies four residues that enhance the affinity of the carrier for its substrates and decrease the rate at which the carrier oscillates between its conformational states.
25124723 SLC46A1 genotype may help to identify patients with increased risk of methotrexate-related toxicity.
25053408 Data indicate that 28/33 cysteine-less proton-coupled folate transporter (PCFT) mutant HeLa cells were active for [(3)H]methotrexate uptake.
24597986 the RFC1 G80A polymorphism does not seem to be a good marker of MTX-related toxicity in pediatric ALL.
24396145 The molecular bases for methotrexate resistance associated with loss of SLC19A1 transport and for hereditary folate malabsorption, attributable to mutant SLC46A1, were determned (review).
More...

AA Sequence

MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRS      1 - 70
ADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLH     71 - 140
VGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYAN    141 - 210
PFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITV    211 - 280
HFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFA    281 - 350
FATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNF    351 - 420
MKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP                                   421 - 459
//

Text Mined References (69)

PMID Year Title
26884338 2016 Identification of an Extracellular Gate for the Proton-coupled Folate Transporter (PCFT-SLC46A1) by Cysteine Cross-linking.
26193446 2015 Expression of Folate Pathway Genes in Stage III Colorectal Cancer Correlates with Recurrence Status Following Adjuvant Bolus 5-FU-Based Chemotherapy.
25877470 2015 Structural determinants of human proton-coupled folate transporter oligomerization: role of GXXXG motifs and identification of oligomeric interfaces at transmembrane domains 3 and 6.
25801697 2015 Sustained inhibition of proton-coupled folate transporter by myricetin.
25697897 2015 DNA methylation and expression of the folate transporter genes in colorectal cancer.
25608532 2015 Identification of Tyr residues that enhance folate substrate binding and constrain oscillation of the proton-coupled folate transporter (PCFT-SLC46A1).
25124723 2014 SLC19A1, SLC46A1 and SLCO1B1 polymorphisms as predictors of methotrexate-related toxicity in Portuguese rheumatoid arthritis patients.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
25053408 2014 Substituted cysteine accessibility reveals a novel transmembrane 2-3 reentrant loop and functional role for transmembrane domain 2 in the human proton-coupled folate transporter.
24597986 2014 Association between reduced folate carrier G80A polymorphism and methotrexate toxicity in childhood acute lymphoblastic leukemia: a meta-analysis.
More...