Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.14
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q96NT3 B5MCB8 B5MCL7 Q96Q79 Q9BU32
Symbols LLN4
C22orf13

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
24743017 The expression and function of a ubiquitous protein, GUCD1, were characterized, it might have a role in regulating normal and abnormal cell growth in the liver.

AA Sequence

MRTEAEAAGPPLEPGDFVQLPVPVIQQLYHWDCGLACSRMVLRYLGQLDDSEFERALQKLQLTRSIWTID      1 - 70
LAYLMHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHL     71 - 140
AQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHHCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYADP    141 - 210
GMCSTSISNFEEARTSYGTDEDILFVYLDS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24743017 2014 NEDD4 controls the expression of GUCD1, a protein upregulated in proliferating liver cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.