Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.28
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
chronic lymphosyte leukemia -1.500 5.8e-09
non primary Sjogren syndrome sicca 1.300 2.3e-02
osteosarcoma -3.054 6.9e-08
ovarian cancer 2.000 2.1e-05
pancreatic ductal adenocarcinoma liver m... -1.919 2.4e-03

Gene RIF (1)

AA Sequence

MRTEAEAAGPPLEPGDFVQLPVPVIQQLYHWDCGLACSRMVLRYLGQLDDSEFERALQKLQLTRSIWTID      1 - 70
LAYLMHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHL     71 - 140
AQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHHCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYADP    141 - 210
GMCSTSISNFEEARTSYGTDEDILFVYLDS                                            211 - 240
//

Text Mined References (9)

PMID Year Title