Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.07
PubTator Score 5.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.393 2.8e-02
adrenocortical carcinoma -1.890 1.9e-02
adult high grade glioma -1.900 1.7e-05
Alzheimer's disease -1.800 2.5e-02
astrocytic glioma -1.600 6.7e-03
atypical teratoid / rhabdoid tumor -3.100 4.2e-05
Breast cancer -1.700 4.1e-07
breast carcinoma -1.100 3.1e-16
ependymoma -2.700 3.5e-02
glioblastoma -1.800 1.6e-04
group 3 medulloblastoma -1.100 9.4e-03
intraductal papillary-mucinous adenoma (... -1.500 2.3e-02
intraductal papillary-mucinous carcinoma... -1.600 2.1e-02
intraductal papillary-mucinous neoplasm ... -1.900 4.7e-02
invasive ductal carcinoma -1.600 1.0e-02
lung carcinoma 1.100 2.0e-21
medulloblastoma, large-cell -2.900 1.7e-07
non-small cell lung cancer -1.125 2.5e-09
oligodendroglioma -1.100 4.7e-02
ovarian cancer -1.900 5.9e-08
pancreatic cancer -1.200 3.5e-03
pancreatic carcinoma -1.200 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.272 2.0e-02
Pick disease -2.300 1.9e-03
ulcerative colitis 1.100 4.9e-05

Synonym

Accession Q96NT1
Symbols DRLM

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFI      1 - 70
ESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEE     71 - 140
EEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK                                141 - 182
//

Text Mined References (12)

PMID Year Title