Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
Funding $239,849.01
PubMed Score 8.73
PubTator Score 5.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20622171 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFI      1 - 70
ESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEE     71 - 140
EEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK                                141 - 182
//

Text Mined References (12)

PMID Year Title
21324877 2011 A novel approach identifies new differentially methylated regions (DMRs) associated with imprinted genes.
21166792 2011 A case-by-case evolutionary analysis of four imprinted retrogenes.
20622171 2010 Large copy-number variations are enriched in cases with moderate to extreme obesity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17291163 2007 A screen for retrotransposed imprinted genes reveals an association between X chromosome homology and maternal germ-line methylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...