Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.11
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.100 1.1e-06
medulloblastoma, large-cell -1.200 3.5e-04
ovarian cancer -1.300 4.3e-06
ulcerative colitis -1.100 5.0e-10

 GO Function (1)

Gene RIF (2)

AA Sequence

MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH      1 - 70
ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS     71 - 140
FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA                                  141 - 180
//

Text Mined References (11)

PMID Year Title