Property Summary

NCBI Gene PubMed Count 6
Grant Count 7
Funding $56,403.5
PubMed Score 1.74
PubTator Score 15.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
lung adenocarcinoma -1.100 0.000
ulcerative colitis -1.100 0.000
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
26833332 Our study reveals CCDC115 deficiency as a disorder of Golgi homeostasis that can be readily identified via screening for abnormal glycosylation in plasma.

AA Sequence

MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH      1 - 70
ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS     71 - 140
FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA                                  141 - 180
//

Text Mined References (10)

PMID Year Title
26833332 2016 CCDC115 Deficiency Causes a Disorder of Golgi Homeostasis with Abnormal Protein Glycosylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21118521 2010 Regulation of cell proliferation and apoptosis in neuroblastoma cells by ccp1, a FGF2 downstream gene.
19946888 2010 Defining the membrane proteome of NK cells.
16378758 2006 Expression of coiled-coil protein 1, a novel gene downstream of FGF2, in the developing brain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.