Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma -1.995 0.000
glioblastoma -1.200 0.000
subependymal giant cell astrocytoma -1.569 0.045

Synonym

Accession Q96NS8 Q9BW88
Symbols URLC3
C16orf67
KIAA0664L3
KIAA0664P3

Gene

 Compartment GO Term (0)

AA Sequence

MFLNGNCLETLKKKEPEGGRRRLSHPGNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEIEPFSLWVFPQ      1 - 70
EMVLEIHQLFMDHEYPCHHITSHCTWVAAHWTTSQSCAAWQGCRRACCSTWWKSPAQCTRPTVMSATFET     71 - 140
AQEPGPS                                                                   141 - 147
//

Text Mined References (5)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.