Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 7.6e-08
glioblastoma 5792 3.4e-04
psoriasis 6694 6.8e-04
subependymal giant cell astrocytoma 2287 4.5e-02

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.200 3.4e-04
osteosarcoma -1.995 7.6e-08
psoriasis 1.300 6.8e-04
subependymal giant cell astrocytoma -1.569 4.5e-02

Synonym

Accession Q96NS8 Q9BW88
Symbols URLC3
C16orf67
KIAA0664L3
KIAA0664P3

Gene

 Compartment GO Term (0)

AA Sequence

MFLNGNCLETLKKKEPEGGRRRLSHPGNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEIEPFSLWVFPQ      1 - 70
EMVLEIHQLFMDHEYPCHHITSHCTWVAAHWTTSQSCAAWQGCRRACCSTWWKSPAQCTRPTVMSATFET     71 - 140
AQEPGPS                                                                   141 - 147
//

Text Mined References (5)

PMID Year Title