Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.48
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.0e-09
medulloblastoma, large-cell 6241 2.0e-04

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 2.0e-04
osteosarcoma 1.867 5.0e-09

Synonym

Accession Q96NS5 B2RBC0 Q8WXK0 ASB-16
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MARETFPFTSSMLRSLRLQQEWLEWEDRRRAAAQQCRSRRCPSSPRARLTRPHRSCRDPAVHQALFSGNL      1 - 70
QQVQALFQDEEAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLAIATARGYTDCARHLIRQGAELDAR     71 - 140
VGGRAALHEACARAQFDCVRLLLTFGAKANVLTEEGTTPLHLCTIPESLQCAKLLLEAGATVNLAAGESQ    141 - 210
ETPLHVAAARGLEQHVALYLEHGADVGLRTSQGETALNTACAGAEGPGSCRRHQAAARRLLEAGADARAA    211 - 280
GRKRHTPLHNACANGCGGLAELLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQP    281 - 350
VRPEMLKHCANFPRALEVLLNAYPCVPSCETWVEAVLPELWKEHEAFYSSALCMVNQPRQLQHLARLAVR    351 - 420
ARLGSRCRQGATRLPLPPLLRDYLLLRVEGCIQ                                         421 - 453
//

Text Mined References (9)

PMID Year Title