Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.64996550213853E-12
posterior fossa group B ependymoma 1530 3.17556586994529E-11
tuberculosis 1563 5.52002879552195E-10
medulloblastoma, large-cell 6234 6.35239522195238E-9
osteosarcoma 7933 1.18132310164695E-8
glioblastoma 5572 6.78016742778727E-7
pediatric high grade glioma 2712 1.29718834689325E-6
pilocytic astrocytoma 3086 2.13086252513305E-6
pituitary cancer 1972 1.63331910359805E-5
medulloblastoma 1524 4.41171202938654E-4
breast carcinoma 1614 4.64282704502553E-4
Pick disease 1893 4.82442986562737E-4
primitive neuroectodermal tumor 3031 5.50272093720892E-4
subependymal giant cell astrocytoma 2287 0.00506882863350609
astrocytic glioma 2241 0.00533572515948589

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 0.005
posterior fossa group B ependymoma -3.100 0.000
glioblastoma -3.300 0.000
osteosarcoma -4.952 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -2.400 0.001
tuberculosis -3.100 0.000
breast carcinoma -1.100 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.800 0.000
subependymal giant cell astrocytoma -3.177 0.005
Pick disease -1.600 0.000
pituitary cancer -1.800 0.000

Synonym

Accession Q96NS1 B3KW92 Q2M3U7 Q65Z98
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20555386 Data show that major vault protein (MVP), a lung resistance associated protein, is a binding partner of YPEL4.
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPA      1 - 70
EQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD                  71 - 127
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20555386 2010 MVP interacts with YPEL4 and inhibits YPEL4-mediated activities of the ERK signal pathway.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.