Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 0.005
posterior fossa group B ependymoma -3.100 0.000
glioblastoma -3.300 0.000
osteosarcoma -4.952 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -2.400 0.001
tuberculosis -3.100 0.000
breast carcinoma -1.100 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.800 0.000
subependymal giant cell astrocytoma -3.177 0.005
Pick disease -1.600 0.000
pituitary cancer -1.800 0.000

Synonym

Accession Q96NS1 B3KW92 Q2M3U7 Q65Z98
Symbols

Gene

Gene RIF (2)

PMID Text
20555386 Data show that major vault protein (MVP), a lung resistance associated protein, is a binding partner of YPEL4.
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPA      1 - 70
EQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD                  71 - 127
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20555386 2010 MVP interacts with YPEL4 and inhibits YPEL4-mediated activities of the ERK signal pathway.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.