Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.400 9.9e-05
astrocytic glioma -1.800 5.3e-03
Astrocytoma, Pilocytic -1.800 2.6e-06
atypical teratoid / rhabdoid tumor -4.000 2.6e-12
breast carcinoma -1.100 4.6e-04
ependymoma -2.000 2.5e-02
glioblastoma -2.400 3.2e-08
group 3 medulloblastoma -2.100 2.3e-03
medulloblastoma, large-cell -4.500 6.4e-09
osteosarcoma -4.952 1.2e-08
Pick disease -1.600 4.8e-04
pituitary cancer -1.800 1.6e-05
primitive neuroectodermal tumor -2.400 5.5e-04
subependymal giant cell astrocytoma -3.177 5.1e-03
tuberculosis -3.100 5.5e-10

Synonym

Accession Q96NS1 B3KW92 Q2M3U7 Q65Z98
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPA      1 - 70
EQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD                  71 - 127
//

Text Mined References (8)

PMID Year Title