Property Summary

NCBI Gene PubMed Count 36
PubMed Score 38.91
PubTator Score 39.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
gastric carcinoma -2.100 4.1e-02
lung carcinoma 2.200 1.2e-09
osteosarcoma 1.170 1.5e-05
pancreatic ductal adenocarcinoma liver m... -1.158 2.3e-03
psoriasis 1.100 1.0e-26

Protein-protein Interaction (11)

Gene RIF (24)

AA Sequence

MLVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIAC      1 - 70
RDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGF     71 - 140
ETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLF    141 - 210
TRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGK    211 - 280
YFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE                                      281 - 316
//

Text Mined References (39)

PMID Year Title