Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96NR2 Q52LN1
Symbols C20orf200
NCRNA00335
C20orf166-AS1

 Compartment GO Term (0)

AA Sequence

MQTLATGHLAHEGSSPHKLSGGRTQESSGFSEAKGGHGAPRHSASHGATPSGLRRGLHCREGPSDSGFQP      1 - 70
HPGPPLSVPSGPLAPRARRHPNPLGMSVLRMWHTRPGRAILLLLHPPQPWIRGLYRGQKFTQSR           71 - 134
//

Text Mined References (6)

PMID Year Title