Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.272 0.000
psoriasis -1.600 0.000

Synonym

Accession Q96NR2 Q52LN1
Symbols C20orf200
NCRNA00335

 Compartment GO Term (0)

AA Sequence

MQTLATGHLAHEGSSPHKLSGGRTQESSGFSEAKGGHGAPRHSASHGATPSGLRRGLHCREGPSDSGFQP      1 - 70
HPGPPLSVPSGPLAPRARRHPNPLGMSVLRMWHTRPGRAILLLLHPPQPWIRGLYRGQKFTQSR           71 - 134
//

Text Mined References (6)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.