Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.03
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.138 2.8e-02
active ulcerative colitis -1.946 5.8e-03
adult high grade glioma -2.200 1.5e-06
astrocytic glioma -1.400 3.1e-03
Astrocytoma, Pilocytic -2.500 2.5e-14
atypical teratoid / rhabdoid tumor -1.900 4.3e-09
glioblastoma -2.300 1.3e-11
group 3 medulloblastoma -2.800 1.5e-08
medulloblastoma, large-cell -2.300 5.0e-07
oligodendroglioma -1.200 8.1e-13
primitive neuroectodermal tumor -2.100 1.2e-07
subependymal giant cell astrocytoma -1.943 3.6e-03
tuberculosis 1.300 3.3e-07

Gene RIF (7)

AA Sequence

MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEA      1 - 70
AVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTG     71 - 140
DLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCA    141 - 210
ETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKV    211 - 280
VFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAY    281 - 350
LTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA    351 - 420
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAH    421 - 490
AQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVAS    491 - 560
MNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWLTGKGS                             561 - 605
//

Text Mined References (16)

PMID Year Title