Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 4
Funding $526,750
PubMed Score 2.96
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (6)

PMID Text
22550867 The expression of apoptosis-inducing factor was identified in pineal gland and thymus, but it did not change with age.
22387901 AIFM3 is a direct target of miR-210 in human hepatoma cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19166416 H. pylori triggers apoptosis in AGS cells via interaction with death receptors in the plasma membrane, leading to the cleavage of procaspase-8, release of cytochrome c and AIF from mitochondria, and activation of subsequent downstream apoptotic events
16001080 AIF maintains the transformed state of colon cancer cells through its NADH oxidase activity, by mechanisms that involve complex I function.
15764604 AIFL has 598 amino acids, with a characteristic Rieske domain and a pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). AIFL shares 35% homology with AIF, mainly in the Pyr_redox domain.

AA Sequence

MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEA      1 - 70
AVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTG     71 - 140
DLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCA    141 - 210
ETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKV    211 - 280
VFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAY    281 - 350
LTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA    351 - 420
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAH    421 - 490
AQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVAS    491 - 560
MNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWLTGKGS                             561 - 605
//

Text Mined References (15)

PMID Year Title
22550867 2011 [Expression of AIF and CGRP markers in pineal gland and thymus during aging].
22387901 2012 Downregulation of miR-210 expression inhibits proliferation, induces apoptosis and enhances radiosensitivity in hypoxic human hepatoma cells in vitro.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19166416 2008 H. pylori-induced apoptosis in human gastric cancer cells mediated via the release of apoptosis-inducing factor from mitochondria.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16001080 2005 AIF suppresses chemical stress-induced apoptosis and maintains the transformed state of tumor cells.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15764604 2005 Molecular cloning and characterization of a human AIF-like gene with ability to induce apoptosis.
More...