Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.51
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.100 1.3e-02
aldosterone-producing adenoma -1.554 1.6e-03
astrocytic glioma -1.600 1.5e-02
chronic lymphosyte leukemia 1.300 1.0e-02
cystic fibrosis 1.384 8.9e-05
ependymoma -1.600 9.8e-04
group 3 medulloblastoma -2.800 3.4e-03
lung adenocarcinoma -1.600 6.1e-14
medulloblastoma, large-cell -3.700 3.0e-04
non-small cell lung cancer -1.656 3.7e-13
Polycystic ovary syndrome -1.380 4.2e-03
primary Sjogren syndrome 1.800 4.2e-05
tuberculosis -1.600 3.8e-05
ulcerative colitis 1.500 1.9e-03

Gene RIF (5)

AA Sequence

MQQTRTEAVAGAFSRCLGFCGMRLGLLLLARHWCIAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQS      1 - 70
ENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLL     71 - 140
SGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGIRSSIAHSSPSPPGSKSATP    141 - 210
SPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSA    211 - 280
TFGDVSKIVASMWDSLGEEQKQSSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGA    281 - 350
SPASLARTLGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMAL    351 - 420
QVQLAMSPSPPGPQDFPHISEFPSSSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT      421 - 488
//

Text Mined References (11)

PMID Year Title