Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.59
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96NM4 A8K1J1 E1P5X0 G3XAC7 Q5TE33 Q5TE34 Q5TE35 Q96IC9 Q9BQN5
Symbols GCX1
GCX-1
C20orf100
dJ495O3.1
dJ1108D11.2

Gene

Gene RIF (5)

PMID Text
25352127 TOX2 plays a crucial role in controlling normal NK cell development by acting upstream of TBX21 transcriptional regulation
22496870 A novel aberrantly hypermethylated CpG island in cancer was discovered within the TOX2 promoter. TOX2 was unmethylated in normal cells. Expression of two novel TOX2 transcripts was significantly reduced in primary lung tumors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
14764631 Identification and functional analysis of the rat Gcx1 ortholog.

AA Sequence

MQQTRTEAVAGAFSRCLGFCGMRLGLLLLARHWCIAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQS      1 - 70
ENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLL     71 - 140
SGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGIRSSIAHSSPSPPGSKSATP    141 - 210
SPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSA    211 - 280
TFGDVSKIVASMWDSLGEEQKQSSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGA    281 - 350
SPASLARTLGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMAL    351 - 420
QVQLAMSPSPPGPQDFPHISEFPSSSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT      421 - 488
//

Text Mined References (11)

PMID Year Title
25352127 2014 TOX2 regulates human natural killer cell development by controlling T-BET expression.
22496870 2012 Differential epigenetic regulation of TOX subfamily high mobility group box genes in lung and breast cancers.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14764631 2004 Cloning and characterization of granulosa cell high-mobility group (HMG)-box protein-1, a novel HMG-box transcriptional regulator strongly expressed in rat ovarian granulosa cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...