Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.54
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.8e-04
atypical teratoid / rhabdoid tumor -2.000 1.8e-06
glioblastoma -1.400 1.6e-04
pediatric high grade glioma -1.500 7.3e-04
posterior fossa group A ependymoma 1.600 2.5e-08
subependymal giant cell astrocytoma -1.722 5.6e-03

Gene RIF (1)

AA Sequence

MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSS      1 - 70
LQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELG     71 - 140
WENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVTGILLVIISYIVPREVTVDPNTVA    141 - 210
AREMERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNF    211 - 280
RMKTSTNENTLELSLVEEDALAVQS                                                 281 - 305
//

Text Mined References (7)

PMID Year Title