Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.40
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.43456261207121E-9
pilocytic astrocytoma 3086 1.01944510213215E-7
atypical teratoid / rhabdoid tumor 4369 1.77800343338879E-6
pediatric high grade glioma 2712 7.28068229595541E-4
glioblastoma 5572 0.00144398972604888
subependymal giant cell astrocytoma 2287 0.00562776236426292
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Fuchs' endothelial dystrophy 20 3.742 1.9

Expression

  Differential Expression (6)

Synonym

Accession Q96NL1
Symbols NET36

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
18294959 These findings demonstrate that TMEM74 may be involved in promoting functional autophagy during cell starvation and other stress conditions.

AA Sequence

MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSS      1 - 70
LQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELG     71 - 140
WENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVTGILLVIISYIVPREVTVDPNTVA    141 - 210
AREMERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNF    211 - 280
RMKTSTNENTLELSLVEEDALAVQS                                                 281 - 305
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19029833 2009 High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
18294959 2008 TMEM74, a lysosome and autophagosome protein, regulates autophagy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.