Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.37
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22846052 The ABCB1 nested gene RUNDC3B expression, although upregulated by TSA, is independent of the ABCB1 alternative promoter used.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15986426 activation of Rap2-binding protein 9 (RPIP9) occurs during the malignant breast epithelial transformation and increases with progression toward an invasive phenotype
12645870 During a large-scale screen of a human fetal brain cDNA library, a full-length cDNA encoding a novel Rap2-interacting protein was isolated and sequenced. The gene was mapped to human chromosome 7q21-q22 and has 9 exons and 8 introns.

AA Sequence

MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAIL      1 - 70
EQILSHRLKEISQSCRWLAHLQIPLQGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRA     71 - 140
KGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFCLKGEGLDG    141 - 210
SFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTL    211 - 280
EQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQEL    281 - 350
TAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTL    351 - 420
NVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS                     421 - 473
//

Text Mined References (11)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
22846052 2012 Dual regulation of P-glycoprotein expression by trichostatin A in cancer cell lines.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15986426 2005 Expression of RPIP9 (Rap2 interacting protein 9) is activated in breast carcinoma and correlates with a poor prognosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12645870 2003 Cloning, expression, and genomic structure of a novel human Rap2 interacting gene (RPIP9).
More...