Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.37
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.700 3.2e-03
ependymoma -3.200 1.5e-02
oligodendroglioma -2.000 1.7e-02
glioblastoma -3.100 3.5e-06
atypical teratoid / rhabdoid tumor -3.700 4.8e-06
medulloblastoma, large-cell -2.600 4.4e-03
pancreatic ductal adenocarcinoma liver m... -2.163 4.6e-04
non-small cell lung cancer -1.506 6.9e-10
intraductal papillary-mucinous adenoma (... -2.600 4.2e-05
intraductal papillary-mucinous carcinoma... -2.600 3.5e-04
intraductal papillary-mucinous neoplasm ... -2.700 2.1e-03
colon cancer -1.500 3.4e-03
lung cancer -1.600 5.3e-03
active Crohn's disease -2.348 2.5e-02
ulcerative colitis -2.800 1.7e-07
adult high grade glioma -3.000 3.1e-06
pilocytic astrocytoma -2.100 2.1e-08
progressive supranuclear palsy 1.100 1.4e-02
Breast cancer -1.300 5.8e-05
invasive ductal carcinoma -2.000 2.6e-03
ovarian cancer -2.300 6.5e-08

Gene RIF (5)

PMID Text
22846052 The ABCB1 nested gene RUNDC3B expression, although upregulated by TSA, is independent of the ABCB1 alternative promoter used.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15986426 activation of Rap2-binding protein 9 (RPIP9) occurs during the malignant breast epithelial transformation and increases with progression toward an invasive phenotype
12645870 During a large-scale screen of a human fetal brain cDNA library, a full-length cDNA encoding a novel Rap2-interacting protein was isolated and sequenced. The gene was mapped to human chromosome 7q21-q22 and has 9 exons and 8 introns.

AA Sequence

MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAIL      1 - 70
EQILSHRLKEISQSCRWLAHLQIPLQGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRA     71 - 140
KGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFCLKGEGLDG    141 - 210
SFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTL    211 - 280
EQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQEL    281 - 350
TAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTL    351 - 420
NVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS                     421 - 473
//

Text Mined References (11)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
22846052 2012 Dual regulation of P-glycoprotein expression by trichostatin A in cancer cell lines.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15986426 2005 Expression of RPIP9 (Rap2 interacting protein 9) is activated in breast carcinoma and correlates with a poor prognosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12645870 2003 Cloning, expression, and genomic structure of a novel human Rap2 interacting gene (RPIP9).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.