Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.47
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease -1.937 1.5e-02
active ulcerative colitis -2.291 1.3e-02
adult high grade glioma -2.900 1.5e-06
astrocytic glioma -2.300 4.5e-03
Astrocytoma, Pilocytic -2.000 2.2e-08
atypical teratoid / rhabdoid tumor -3.300 3.2e-06
Breast cancer -1.300 5.8e-05
colon cancer -1.500 3.4e-03
ependymoma -2.800 1.7e-02
glioblastoma -2.400 3.5e-09
intraductal papillary-mucinous adenoma (... -2.600 4.2e-05
intraductal papillary-mucinous carcinoma... -2.600 3.5e-04
intraductal papillary-mucinous neoplasm ... -2.700 2.1e-03
invasive ductal carcinoma -1.400 2.3e-03
lung cancer -1.600 5.3e-03
medulloblastoma, large-cell -1.900 1.7e-02
non-small cell lung cancer -1.374 5.1e-10
oligodendroglioma -1.900 1.6e-02
ovarian cancer -2.300 6.5e-08
pancreatic ductal adenocarcinoma liver m... -2.163 4.6e-04
progressive supranuclear palsy 1.100 1.4e-02

Gene RIF (6)

AA Sequence

MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAIL      1 - 70
EQILSHRLKEISQSCRWLAHLQIPLQGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRA     71 - 140
KGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFCLKGEGLDG    141 - 210
SFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTL    211 - 280
EQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQEL    281 - 350
TAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTL    351 - 420
NVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS                     421 - 473
//

Text Mined References (12)

PMID Year Title