Property Summary

NCBI Gene PubMed Count 10
Grant Count 11
R01 Count 11
Funding $814,421.98
PubMed Score 32.42
PubTator Score 30.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.800 0.019
oligodendroglioma -1.500 0.027
astrocytoma -1.600 0.001
glioblastoma -1.800 0.000
osteosarcoma 1.067 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
primitive neuroectodermal tumor -1.600 0.005
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.600 0.000
Pick disease -1.300 0.014

Gene RIF (4)

PMID Text
26395074 single nucleotide polymorphisms in either the region of NEUROD6 or SNAP25 were significantly associated with Alzheimer's Disease, in APOE4+ females and APOE4+ males, respectively.
25548427 NeuroD6 serves as a possible biomarker for Alzheimer disease brains.
19733838 Observational study of gene-disease association. (HuGE Navigator)
12357074 cloning and some features of a novel human gene, MATH2, which encodes a protein of 337 amino acid residues with a basic helix loop helix domain and exhibits 98% similarity to mouse Math2

AA Sequence

MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDE      1 - 70
NGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAK     71 - 140
NYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPP    141 - 210
YHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLD    211 - 280
YGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN                 281 - 337
//

Text Mined References (10)

PMID Year Title
26395074 2015 Leveraging existing data sets to generate new insights into Alzheimer's disease biology in specific patient subsets.
25548427 2014 RNA-Seq data mining: downregulation of NeuroD6 serves as a possible biomarker for alzheimer's disease brains.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
19733838 2009 Case-control study of six genes asymmetrically expressed in the two cerebral hemispheres: association of BAIAP2 with attention-deficit/hyperactivity disorder.
15036409 2004 AT-hook proteins stimulate induction of senescence markers triggered by 5-bromodeoxyuridine in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12357074 2002 Cloning, chromosome localization and features of a novel human gene, MATH2.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.