Property Summary

NCBI Gene PubMed Count 10
PubMed Score 32.78
PubTator Score 30.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.400 2.2e-28
Astrocytoma, Pilocytic -1.600 4.1e-05
atypical teratoid / rhabdoid tumor -1.500 9.4e-06
ependymoma -1.800 1.9e-02
glioblastoma -1.400 1.1e-04
oligodendroglioma -1.500 2.7e-02
osteosarcoma 1.067 2.8e-04
pediatric high grade glioma -1.400 2.2e-04
Pick disease -1.300 1.4e-02
primitive neuroectodermal tumor -1.600 5.3e-03

Gene RIF (4)

AA Sequence

MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDE      1 - 70
NGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAK     71 - 140
NYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPP    141 - 210
YHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLD    211 - 280
YGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN                 281 - 337
//

Text Mined References (10)

PMID Year Title