Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.36
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 1.33221400396881E-6
hepatocellular carcinoma 550 1.50485537809119E-6
cystic fibrosis 1670 6.81888298660165E-5
tuberculosis and treatment for 6 months 686 8.1418681533742E-4
osteosarcoma 7933 0.00194145622627019
gastric cancer 436 0.00331905838515464
ependymoma 2514 0.0122872654170498

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.200 0.003
hepatocellular carcinoma 1.600 0.000
ependymoma 1.600 0.012
osteosarcoma -1.072 0.002
cystic fibrosis -1.449 0.000
tuberculosis and treatment for 6 months -1.200 0.001
ulcerative colitis -1.200 0.000

Synonym

Accession Q96NJ6 A5PLL4 Zfp-3
Symbols ZNF752

Gene

  Ortholog (6)

AA Sequence

MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFP      1 - 70
SGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKP     71 - 140
HTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSS    141 - 210
HLIHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERY    211 - 280
HECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNS    281 - 350
EIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKP    351 - 420
HQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSS    421 - 490
HLLRHQSVHCME                                                              491 - 502
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.