Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.58
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.125 3.4e-02
adult high grade glioma -1.300 1.9e-02
atypical teratoid / rhabdoid tumor -2.900 3.1e-08
chronic rhinosinusitis -1.437 2.2e-02
glioblastoma -1.500 7.1e-03
group 4 medulloblastoma -2.500 2.7e-05
medulloblastoma, large-cell -2.200 2.9e-04
pituitary cancer 1.700 8.9e-04
posterior fossa group B ependymoma 1.200 2.1e-03
subependymal giant cell astrocytoma -2.045 1.3e-02

AA Sequence

MPSERCLSIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIAEEQKFHAHKAVLAACSDYFRAM      1 - 70
FSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN     71 - 140
SFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQL    141 - 210
AVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTR    211 - 280
RTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENALIAAIANWSELAPMPVGRSHHCVAVMGDFLFV    281 - 350
AGGEVEHASGRTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYC    351 - 420
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPMLQRRVYHSMA    421 - 490
AVQRKLYVLGGNDLDYNNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRIYLVGGYSIWTN    491 - 560
EPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGTI              561 - 620
//

Text Mined References (9)

PMID Year Title