Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96NJ1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRRERPELRDAEGRLRLRAGCLVTAWPRAPSGAGSWSMAAASPWPASWGFPDASSTVPSLCTEARAGRGG      1 - 70
PATARSRVSADSQGGRAGSSSPSSALRLCCAGPSQAHPGPSPAVLPGRCGLLGSFPRPPAPQGRWGPSLG     71 - 140
//

Text Mined References (5)

PMID Year Title
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.