Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.64
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.030 2.1e-05
adult high grade glioma -3.600 1.2e-06
astrocytic glioma -2.300 3.2e-03
Astrocytoma, Pilocytic -1.500 7.8e-04
Atopic dermatitis -1.600 4.5e-06
atypical teratoid / rhabdoid tumor -4.000 3.8e-07
ependymoma -2.500 5.8e-03
glioblastoma -3.100 2.7e-06
group 4 medulloblastoma -2.800 3.5e-04
intraductal papillary-mucinous carcinoma... -1.300 1.4e-04
intraductal papillary-mucinous neoplasm ... -1.400 2.0e-03
invasive ductal carcinoma -1.653 3.7e-03
medulloblastoma, large-cell -3.500 2.5e-04
oligodendroglioma -2.100 8.9e-03
ovarian cancer -1.900 1.2e-10
pituitary cancer 3.600 7.5e-10
primitive neuroectodermal tumor -2.800 9.3e-03
psoriasis -1.400 1.3e-32

Gene RIF (3)

AA Sequence

MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKD      1 - 70
FANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISS     71 - 140
TAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKL    141 - 210
PPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEE    211 - 280
EFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVK    281 - 350
DTGAFTCIASNPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK    351 - 420
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGTMYDLCVLAIY    421 - 490
DDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNGQ    491 - 560
HKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENAQCCKATSDNVIQSSETCSSQDSSTTTSALP    561 - 630
PSWTSSTSVSQKQKRKTGTKPSTEPQNEAVTNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPN    631 - 700
ALLTNVDQIVQETQRLELI                                                       701 - 719
//

Text Mined References (15)

PMID Year Title