Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.97
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 1.25387629390441E-32
ovarian cancer 8492 1.22943400019847E-10
pituitary cancer 1972 7.54029339426094E-10
ependymoma 2514 2.70787833200828E-9
atypical teratoid / rhabdoid tumor 4369 3.82400374245179E-7
adult high grade glioma 2148 1.22966991356365E-6
Atopic dermatitis 944 4.48170144285039E-6
glioblastoma 5572 1.91499919949097E-5
adrenocortical carcinoma 1427 2.13069935642851E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.441485680585E-4
medulloblastoma, large-cell 6234 2.54717622060149E-4
group 4 medulloblastoma 1875 3.49285109548393E-4
pilocytic astrocytoma 3086 9.15640617843126E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00195557181799834
astrocytic glioma 2241 0.00323028821322094
invasive ductal carcinoma 2950 0.00374294309330179
oligodendroglioma 2849 0.00885113911505631
primitive neuroectodermal tumor 3031 0.00925468512075811
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Autistic Disorder 320 3.595 1.8

Expression

  Differential Expression (18)

Synonym

Accession Q96NI6 B3KU78 Q86XL2
Symbols SALM5
FIGLER8
C14orf146

Gene

  Ortholog (14)

Gene RIF (3)

PMID Text
21736948 SALM5/Lrfn5, has recently been implicated in severe progressive autism and familial schizophrenia, pointing to the clinical importance of SALMs.[review]
20410109 Expression of SALM family proteins SALM3 and SALM5 in nonneural and neural cells induces both excitatory and inhibitory presynaptic differentiation in contacting axons.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKD      1 - 70
FANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISS     71 - 140
TAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKL    141 - 210
PPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEE    211 - 280
EFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVK    281 - 350
DTGAFTCIASNPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK    351 - 420
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGTMYDLCVLAIY    421 - 490
DDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNGQ    491 - 560
HKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENAQCCKATSDNVIQSSETCSSQDSSTTTSALP    561 - 630
PSWTSSTSVSQKQKRKTGTKPSTEPQNEAVTNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPN    631 - 700
ALLTNVDQIVQETQRLELI                                                       701 - 719
//

Text Mined References (15)

PMID Year Title
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
21736948 2011 The SALM/Lrfn family of leucine-rich repeat-containing cell adhesion molecules.
20410109 2010 Selected SALM (synaptic adhesion-like molecule) family proteins regulate synapse formation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18585462 2008 Synaptic adhesion-like molecules (SALMs) promote neurite outgrowth.
18227064 2008 The SALM family of adhesion-like molecules forms heteromeric and homomeric complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16828986 2006 Comparative analysis of structure, expression and PSD95-binding capacity of Lrfn, a novel family of neuronal transmembrane proteins.
16630835 2006 SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses.
More...